LOCUS V00573 789 bp mRNA linear HUM 18-APR-2005 DEFINITION Human mRNA encoding placental lactogen hormone. ACCESSION V00573 VERSION V00573.1 KEYWORDS complementary DNA; lactogen; placental lactogen; signal peptide. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 789) AUTHORS Barrera-Saldana H.A., Seeburg P.H., Saunders G.F. TITLE Two structurally different genes produce the same secreted human placental lactogen hormone JOURNAL J Biol Chem 258(6), 3787-3793(1983). PUBMED 6300056 REFERENCE 2 AUTHORS Seeburg P.H. TITLE The human growth hormone gene family: nucleotide sequences show recent divergence and predict a new polypeptide hormone JOURNAL DNA 1(3), 239-249(1982). PUBMED 7169009 REMARK peptide sequence REFERENCE 3 AUTHORS Barrera-Saldana H.A. JOURNAL Submitted (30-MAY-1983) to the INSDC. REMARK correction to position of variant COMMENT Data kindly reviewed (30-MAY-1983) by H.A. Barrera-Saldana. FEATURES Location/Qualifiers source 1..789 /db_xref="H-InvDB:HIT000320838" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" mRNA 1..789 /note="messenger RNA" variation 20..20 /note="C may be T" CDS 25..678 /note="lactogen" /db_xref="GOA:P0DML3" /db_xref="H-InvDB:HIT000320838.14" /db_xref="HGNC:HGNC:2441" /db_xref="InterPro:IPR001400" /db_xref="InterPro:IPR009079" /db_xref="InterPro:IPR018116" /db_xref="UniProtKB/Swiss-Prot:P0DML3" /protein_id="CAA23836.1" /translation="MAAGSRTSLLLAFALLCLPWLQEAGAVQTVPLSRLFDHAMLQAH RAHQLAIDTYQEFEETYIPKDQKYSFLHDSQTSFCFSDSIPTPSNMEETQQKSNLELL RISLLLIESWLEPVRFLRSMFANNLVYDTSDSDDYHLLKDLEEGIQTLMGRLEDGSRR TGQILKQTYSKFDTNSHNHDALLKNYGLLYCFRKDMDKVETFLRMVQCRSVEGSCGF" sig_peptide 25..105 /note="signal peptide" misc_feature 31..31 /note="peptide sequence in [2] indicates C, [1] gives G" BASE COUNT 176 a 251 c 193 g 169 t ORIGIN 1 ctgtggacag ctcacctagc ggcaatggct gcaggctccc ggacgtccct gctcctggct 61 tttgccctgc tctgcctgcc ctggcttcaa gaggctggtg ccgtccaaac cgttccgtta 121 tccaggcttt ttgaccacgc tatgctccaa gcccatcgcg cgcaccagct ggccattgac 181 acctaccagg agtttgaaga aacctatatc ccaaaggacc agaagtattc attcctgcat 241 gactcccaga cctccttctg cttctcagac tctattccga caccctccaa catggaggaa 301 acgcaacaga aatccaatct agagctgctc cgcatctccc tgctgctcat cgagtcgtgg 361 ctggagcccg tgcggttcct caggagtatg ttcgccaaca acctggtgta tgacacctcg 421 gacagcgatg actatcacct cctaaaggac ctagaggaag gcatccaaac gctgatgggg 481 aggctggaag acggcagccg ccggactggg cagatcctca agcagaccta cagcaagttt 541 gacacaaact cacacaacca tgacgcactg ctcaagaact acgggctgct ctactgcttc 601 aggaaggaca tggacaaggt cgagacattc ctgcgcatgg tgcagtgccg ctctgtagag 661 ggtagctgtg gcttctaggt gcccgcgtgg catcctgtga ccgacccctc cccagtgcct 721 ctcctggccc ctggaaggtg ccactcagtg cccatcagcc ttgtcctaat aaaattaagt 781 tgtatcatc //