LOCUS       V00573                   789 bp    mRNA    linear   HUM 18-APR-2005
DEFINITION  Human mRNA encoding placental lactogen hormone.
ACCESSION   V00573
VERSION     V00573.1
KEYWORDS    complementary DNA; lactogen; placental lactogen; signal peptide.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 789)
  AUTHORS   Barrera-Saldana H.A., Seeburg P.H., Saunders G.F.
  TITLE     Two structurally different genes produce the same secreted human
            placental lactogen hormone
  JOURNAL   J Biol Chem 258(6), 3787-3793(1983).
   PUBMED   6300056
REFERENCE   2
  AUTHORS   Seeburg P.H.
  TITLE     The human growth hormone gene family: nucleotide sequences show
            recent divergence and predict a new polypeptide hormone
  JOURNAL   DNA 1(3), 239-249(1982).
   PUBMED   7169009
  REMARK    peptide sequence
REFERENCE   3
  AUTHORS   Barrera-Saldana H.A.
  JOURNAL   Submitted (30-MAY-1983) to the INSDC.
  REMARK    correction to position of variant
COMMENT     Data kindly reviewed (30-MAY-1983) by H.A. Barrera-Saldana.
FEATURES             Location/Qualifiers
     source          1..789
                     /db_xref="H-InvDB:HIT000320838"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
     mRNA            1..789
                     /note="messenger RNA"
     variation       20..20
                     /note="C may be T"
     CDS             25..678
                     /note="lactogen"
                     /db_xref="GOA:P0DML3"
                     /db_xref="H-InvDB:HIT000320838.14"
                     /db_xref="HGNC:HGNC:2441"
                     /db_xref="InterPro:IPR001400"
                     /db_xref="InterPro:IPR009079"
                     /db_xref="InterPro:IPR018116"
                     /db_xref="UniProtKB/Swiss-Prot:P0DML3"
                     /protein_id="CAA23836.1"
                     /translation="MAAGSRTSLLLAFALLCLPWLQEAGAVQTVPLSRLFDHAMLQAH
                     RAHQLAIDTYQEFEETYIPKDQKYSFLHDSQTSFCFSDSIPTPSNMEETQQKSNLELL
                     RISLLLIESWLEPVRFLRSMFANNLVYDTSDSDDYHLLKDLEEGIQTLMGRLEDGSRR
                     TGQILKQTYSKFDTNSHNHDALLKNYGLLYCFRKDMDKVETFLRMVQCRSVEGSCGF"
     sig_peptide     25..105
                     /note="signal peptide"
     misc_feature    31..31
                     /note="peptide sequence in [2] indicates C, [1] gives G"
BASE COUNT          176 a          251 c          193 g          169 t
ORIGIN      
        1 ctgtggacag ctcacctagc ggcaatggct gcaggctccc ggacgtccct gctcctggct
       61 tttgccctgc tctgcctgcc ctggcttcaa gaggctggtg ccgtccaaac cgttccgtta
      121 tccaggcttt ttgaccacgc tatgctccaa gcccatcgcg cgcaccagct ggccattgac
      181 acctaccagg agtttgaaga aacctatatc ccaaaggacc agaagtattc attcctgcat
      241 gactcccaga cctccttctg cttctcagac tctattccga caccctccaa catggaggaa
      301 acgcaacaga aatccaatct agagctgctc cgcatctccc tgctgctcat cgagtcgtgg
      361 ctggagcccg tgcggttcct caggagtatg ttcgccaaca acctggtgta tgacacctcg
      421 gacagcgatg actatcacct cctaaaggac ctagaggaag gcatccaaac gctgatgggg
      481 aggctggaag acggcagccg ccggactggg cagatcctca agcagaccta cagcaagttt
      541 gacacaaact cacacaacca tgacgcactg ctcaagaact acgggctgct ctactgcttc
      601 aggaaggaca tggacaaggt cgagacattc ctgcgcatgg tgcagtgccg ctctgtagag
      661 ggtagctgtg gcttctaggt gcccgcgtgg catcctgtga ccgacccctc cccagtgcct
      721 ctcctggccc ctggaaggtg ccactcagtg cccatcagcc ttgtcctaat aaaattaagt
      781 tgtatcatc
//