LOCUS HSU82962 346 bp mRNA linear HUM 26-JUL-2016 DEFINITION Human anti-HIV-1 gp120 V3 loop antibody DO142-10 light chain variable region mRNA, partial cds. ACCESSION U82962 VERSION U82962.1 KEYWORDS . SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 346) AUTHORS Ditzel,H.J., Parren,P.W., Binley,J.M., Sodroski,J., Moore,J.P., Barbas,C.F. III and Burton,D.R. TITLE Mapping the protein surface of human immunodeficiency virus type 1 gp120 using human monoclonal antibodies from phage display libraries JOURNAL J. Mol. Biol. 267 (3), 684-695 (1997) PUBMED 9126846 REFERENCE 2 (bases 1 to 346) AUTHORS Ditzel,H.J., Parren,P.W.H.I., Binley,J.M., Sodroski,J., Moore,J.P., Barbas,C.F. and Burton,D.R. TITLE Direct Submission JOURNAL Submitted (20-DEC-1996) Immunology, The Scripps Research Institute, 10550 North Torrey Pines Road (IMM2), La Jolla, CA 92037, USA FEATURES Location/Qualifiers source 1..346 /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" CDS <1..>346 /codon_start=1 /product="anti-HIV-1 gp120 V3 loop antibody DO142-10 light chain variable region" /protein_id="AAB41426.1" /translation="MAELTQSPDSLAVSLGERATINCKSSQTVFYNSNKKNYLAWYRQ KSGQSPELLISWASTRESGVPDRFSGSGSGTDFTLTISSLQAEDVAVYYCQQYYNVPF TFGPGTKVDIKRT" BASE COUNT 84 a 97 c 83 g 82 t ORIGIN 1 atggccgagc tcactcagtc tccagactcc ctggctgtgt ctctgggcga gagggccacc 61 atcaactgca agtccagcca gactgttttt tacaactcca acaagaagaa ctacttagcc 121 tggtaccggc agaaatcagg gcagtctcct gaactactca tttcctgggc atctacccgg 181 gaatccgggg tccctgaccg attcagtggc agcgggtctg ggacagattt cactctcacc 241 atcagcagcc tgcaggctga agatgtggca gtttattact gtcagcaata ttataatgtt 301 ccattcactt tcggccctgg gaccaaagtg gatatcaaac gaactg //