LOCUS       HSU82962                 346 bp    mRNA    linear   HUM 26-JUL-2016
DEFINITION  Human anti-HIV-1 gp120 V3 loop antibody DO142-10 light chain
            variable region mRNA, partial cds.
ACCESSION   U82962
VERSION     U82962.1
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 346)
  AUTHORS   Ditzel,H.J., Parren,P.W., Binley,J.M., Sodroski,J., Moore,J.P.,
            Barbas,C.F. III and Burton,D.R.
  TITLE     Mapping the protein surface of human immunodeficiency virus type 1
            gp120 using human monoclonal antibodies from phage display
            libraries
  JOURNAL   J. Mol. Biol. 267 (3), 684-695 (1997)
   PUBMED   9126846
REFERENCE   2  (bases 1 to 346)
  AUTHORS   Ditzel,H.J., Parren,P.W.H.I., Binley,J.M., Sodroski,J., Moore,J.P.,
            Barbas,C.F. and Burton,D.R.
  TITLE     Direct Submission
  JOURNAL   Submitted (20-DEC-1996) Immunology, The Scripps Research Institute,
            10550 North Torrey Pines Road (IMM2), La Jolla, CA 92037, USA
FEATURES             Location/Qualifiers
     source          1..346
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
     CDS             <1..>346
                     /codon_start=1
                     /product="anti-HIV-1 gp120 V3 loop antibody DO142-10 light
                     chain variable region"
                     /protein_id="AAB41426.1"
                     /translation="MAELTQSPDSLAVSLGERATINCKSSQTVFYNSNKKNYLAWYRQ
                     KSGQSPELLISWASTRESGVPDRFSGSGSGTDFTLTISSLQAEDVAVYYCQQYYNVPF
                     TFGPGTKVDIKRT"
BASE COUNT           84 a           97 c           83 g           82 t
ORIGIN      
        1 atggccgagc tcactcagtc tccagactcc ctggctgtgt ctctgggcga gagggccacc
       61 atcaactgca agtccagcca gactgttttt tacaactcca acaagaagaa ctacttagcc
      121 tggtaccggc agaaatcagg gcagtctcct gaactactca tttcctgggc atctacccgg
      181 gaatccgggg tccctgaccg attcagtggc agcgggtctg ggacagattt cactctcacc
      241 atcagcagcc tgcaggctga agatgtggca gtttattact gtcagcaata ttataatgtt
      301 ccattcactt tcggccctgg gaccaaagtg gatatcaaac gaactg
//