LOCUS HSU81005 314 bp mRNA linear HUM 05-JAN-1999 DEFINITION Human ps1ly2h-25 mRNA, partial cds. ACCESSION U81005 VERSION U81005.1 KEYWORDS . SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 314) AUTHORS Levesque,G., Yu,G., Fraser,P.E. and StGeorge-Hyslop,P. TITLE Presenilin 1 interacts with a novel protein which contains armadillo repeats and maps near the Cri du chat locus on chromosome 5p JOURNAL Unpublished REFERENCE 2 (bases 1 to 314) AUTHORS Levesque,G., Yu,G., Fraser,P.E. and StGeorge-Hyslop,P. TITLE Direct Submission JOURNAL Submitted (04-DEC-1996) Dept. of Medicine, University of Toronto, 6 Queen's Park Crescent, Toronto M5S 1A8, Canada FEATURES Location/Qualifiers source 1..314 /db_xref="H-InvDB:HIT000221623" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" gene 1..314 /gene="ps1ly2h-25" CDS <1..276 /gene="ps1ly2h-25" /note="similar to p0071 protein encoded by GenBank Accession Number X81889; armadillo repeat-containing protein similar to GT24 p120(cas), to beta catenin and to armadillo" /codon_start=1 /protein_id="AAD00454.1" /translation="TAFRRTPGEFAWRDPELPEVIHMLQHQFPSVQANAAAYLQHLCF GDNKVKMEVCRLGGIKHLVDLLDHRVLGSSEECLWCPSKPRFWQVYR" BASE COUNT 81 a 65 c 89 g 79 t ORIGIN 1 acagcattca gaaggacccc aggggagttt gcctggcgtg atcctgagtt gcctgaggtc 61 attcacatgc ttcagcacca gttcccatct gttcaggcaa atgcagcggc ctacctgcag 121 cacctgtgct ttggtgacaa caaagtgaag atggaggtgt gtaggttagg gggaatcaag 181 catctggttg accttctgga ccacagagtt ttgggaagtt cagaagaatg cttgtggtgc 241 ccttcgaaac ctcgtttttg gcaagtctac agatgaaaat aaaatagcaa tgaagaatgt 301 tggtgggata ctgc //