LOCUS       HSU81005                 314 bp    mRNA    linear   HUM 05-JAN-1999
DEFINITION  Human ps1ly2h-25 mRNA, partial cds.
ACCESSION   U81005
VERSION     U81005.1
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 314)
  AUTHORS   Levesque,G., Yu,G., Fraser,P.E. and StGeorge-Hyslop,P.
  TITLE     Presenilin 1 interacts with a novel protein which contains
            armadillo repeats and maps near the Cri du chat locus on chromosome
            5p
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 314)
  AUTHORS   Levesque,G., Yu,G., Fraser,P.E. and StGeorge-Hyslop,P.
  TITLE     Direct Submission
  JOURNAL   Submitted (04-DEC-1996) Dept. of Medicine, University of Toronto, 6
            Queen's Park Crescent, Toronto M5S 1A8, Canada
FEATURES             Location/Qualifiers
     source          1..314
                     /db_xref="H-InvDB:HIT000221623"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
     gene            1..314
                     /gene="ps1ly2h-25"
     CDS             <1..276
                     /gene="ps1ly2h-25"
                     /note="similar to p0071 protein encoded by GenBank
                     Accession Number X81889; armadillo repeat-containing
                     protein similar to GT24 p120(cas), to beta catenin and to
                     armadillo"
                     /codon_start=1
                     /protein_id="AAD00454.1"
                     /translation="TAFRRTPGEFAWRDPELPEVIHMLQHQFPSVQANAAAYLQHLCF
                     GDNKVKMEVCRLGGIKHLVDLLDHRVLGSSEECLWCPSKPRFWQVYR"
BASE COUNT           81 a           65 c           89 g           79 t
ORIGIN      
        1 acagcattca gaaggacccc aggggagttt gcctggcgtg atcctgagtt gcctgaggtc
       61 attcacatgc ttcagcacca gttcccatct gttcaggcaa atgcagcggc ctacctgcag
      121 cacctgtgct ttggtgacaa caaagtgaag atggaggtgt gtaggttagg gggaatcaag
      181 catctggttg accttctgga ccacagagtt ttgggaagtt cagaagaatg cttgtggtgc
      241 ccttcgaaac ctcgtttttg gcaagtctac agatgaaaat aaaatagcaa tgaagaatgt
      301 tggtgggata ctgc
//