LOCUS HSU76376 716 bp mRNA linear HUM 09-SEP-1998 DEFINITION Homo sapiens activator of apoptosis Hrk (HRK) mRNA, complete cds. ACCESSION U76376 VERSION U76376.1 KEYWORDS . SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 716) AUTHORS Inohara,N., Ding,L., Chen,S. and Nunez,G. TITLE harakiri, a novel regulator of cell death, encodes a protein that activates apoptosis and interacts selectively with survival-promoting proteins Bcl-2 and Bcl-X(L) JOURNAL EMBO J. 16 (7), 1686-1694 (1997) PUBMED 9130713 REFERENCE 2 (bases 1 to 716) AUTHORS Inohara,N. TITLE Direct Submission JOURNAL Submitted (26-OCT-1996) Department of Pathology and Comprehensive Cancer Center, The University of Michigan Medical School, 1150 W.Medical Center Dr., Ann Arbor, MI 48109, USA FEATURES Location/Qualifiers source 1..716 /db_xref="H-InvDB:HIT000221291" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /dev_stage="9 week embryo" gene 1..716 /gene="HRK" CDS 121..396 /gene="HRK" /note="harakiri; interacts with Bcl-2 and Bcl-xL but not Bax, Bcl-xS and Bak; novel BH3 protein of Bcl-2 family" /codon_start=1 /product="activator of apoptosis Hrk" /protein_id="AAC34931.1" /translation="MCPCPLHRGRGPPAVCACSAGRLGLRSSAAQLTAARLKALGDEL HQRTMWRRRARSRRAPAPGALPTYWPWLCAAAQVAALAAWLLGRRNL" regulatory 651..655 /regulatory_class="other" /gene="HRK" /note="AU-rich mRNA stablization signal" BASE COUNT 151 a 208 c 263 g 94 t ORIGIN 1 gaaacttggt gtccagggga ggcccccggc ggctggagcg cggcggcagc gggcgcagag 61 gccggaggga gaggaggcga ggggcggccc gagcgcgggg cgggagcgag gccagcggtc 121 atgtgcccgt gccccctgca ccgcggccgc ggccccccgg ccgtgtgcgc ctgcagcgcg 181 ggtcgcctgg ggctgcgctc gtccgccgcg cagctcaccg ccgcccggct caaggcgcta 241 ggcgacgagc tgcaccagcg caccatgtgg cggcgccgcg cgcggagccg gagggcgccg 301 gcgcccggcg cgctccccac ctactggcct tggctgtgcg cggccgcgca ggtggcggcg 361 ctggcggcct ggctgctcgg caggcggaac ttgtaggaac gcggggcttc ttggtggggc 421 cggagccgag acccagccgg agcgagcaac aggttggtga aaaccctgtg tccttggaga 481 aagctggttc ccgttttcca gagggggagc ccagagcttg aaaggccgcg gttggcactt 541 cgagaaggaa gtggagagta aagacagcgc ctggagcgat cgtagaaaca cagaatggga 601 ctggggaagc cctttggaaa tccagctgca gaaacagaca ccccaatgct atttacatac 661 agctctatat atataaaaaa agaaaatatg aatattaaaa aaaaaaaaaa aaaaaa //