LOCUS       HSU76376                 716 bp    mRNA    linear   HUM 09-SEP-1998
DEFINITION  Homo sapiens activator of apoptosis Hrk (HRK) mRNA, complete cds.
ACCESSION   U76376
VERSION     U76376.1
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 716)
  AUTHORS   Inohara,N., Ding,L., Chen,S. and Nunez,G.
  TITLE     harakiri, a novel regulator of cell death, encodes a protein that
            activates apoptosis and interacts selectively with
            survival-promoting proteins Bcl-2 and Bcl-X(L)
  JOURNAL   EMBO J. 16 (7), 1686-1694 (1997)
   PUBMED   9130713
REFERENCE   2  (bases 1 to 716)
  AUTHORS   Inohara,N.
  TITLE     Direct Submission
  JOURNAL   Submitted (26-OCT-1996) Department of Pathology and Comprehensive
            Cancer Center, The University of Michigan Medical School, 1150
            W.Medical Center Dr., Ann Arbor, MI 48109, USA
FEATURES             Location/Qualifiers
     source          1..716
                     /db_xref="H-InvDB:HIT000221291"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /dev_stage="9 week embryo"
     gene            1..716
                     /gene="HRK"
     CDS             121..396
                     /gene="HRK"
                     /note="harakiri; interacts with Bcl-2 and Bcl-xL but not
                     Bax, Bcl-xS and Bak; novel BH3 protein of Bcl-2 family"
                     /codon_start=1
                     /product="activator of apoptosis Hrk"
                     /protein_id="AAC34931.1"
                     /translation="MCPCPLHRGRGPPAVCACSAGRLGLRSSAAQLTAARLKALGDEL
                     HQRTMWRRRARSRRAPAPGALPTYWPWLCAAAQVAALAAWLLGRRNL"
     regulatory      651..655
                     /regulatory_class="other"
                     /gene="HRK"
                     /note="AU-rich mRNA stablization signal"
BASE COUNT          151 a          208 c          263 g           94 t
ORIGIN      
        1 gaaacttggt gtccagggga ggcccccggc ggctggagcg cggcggcagc gggcgcagag
       61 gccggaggga gaggaggcga ggggcggccc gagcgcgggg cgggagcgag gccagcggtc
      121 atgtgcccgt gccccctgca ccgcggccgc ggccccccgg ccgtgtgcgc ctgcagcgcg
      181 ggtcgcctgg ggctgcgctc gtccgccgcg cagctcaccg ccgcccggct caaggcgcta
      241 ggcgacgagc tgcaccagcg caccatgtgg cggcgccgcg cgcggagccg gagggcgccg
      301 gcgcccggcg cgctccccac ctactggcct tggctgtgcg cggccgcgca ggtggcggcg
      361 ctggcggcct ggctgctcgg caggcggaac ttgtaggaac gcggggcttc ttggtggggc
      421 cggagccgag acccagccgg agcgagcaac aggttggtga aaaccctgtg tccttggaga
      481 aagctggttc ccgttttcca gagggggagc ccagagcttg aaaggccgcg gttggcactt
      541 cgagaaggaa gtggagagta aagacagcgc ctggagcgat cgtagaaaca cagaatggga
      601 ctggggaagc cctttggaaa tccagctgca gaaacagaca ccccaatgct atttacatac
      661 agctctatat atataaaaaa agaaaatatg aatattaaaa aaaaaaaaaa aaaaaa
//