LOCUS HSU66622 160 bp mRNA linear HUM 10-APR-1997 DEFINITION Human small GTP-binding protein (rab1c) mRNA, partial cds. ACCESSION U66622 VERSION U66622.1 KEYWORDS . SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 160) AUTHORS Chen,D., Guo,J. and Gahl,W.A. TITLE RAB GTPases expressed in human melanoma cells JOURNAL Biochim. Biophys. Acta 1355 (1), 1-6 (1997) PUBMED 9030196 REFERENCE 2 (bases 1 to 160) AUTHORS Chen,D. and Gahl,W.A. TITLE Direct Submission JOURNAL Submitted (09-AUG-1996) Human Genetics Branch, NICHD/NIH, 10 Center Drive MSC1830, Bethesda, MD 20892-1830, USA FEATURES Location/Qualifiers source 1..160 /db_xref="H-InvDB:HIT000220961" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /cell_type="pigmented melanoma cells" gene 1..160 /gene="rab1c" CDS <1..>160 /gene="rab1c" /codon_start=2 /product="small GTP-binding protein" /protein_id="AAC51197.1" /translation="QERFWTITSSYYRGAHGFLVVYDVTDQESYANVKQWLQEIDRHA SENVNKLLV" BASE COUNT 37 a 45 c 45 g 33 t ORIGIN 1 ccaggaacgg ttctggacca tcacttccag ctactaccgg ggggctcatg gcttcctcgt 61 ggtatatgac gtcactgacc aggaatccta tgccaacgtg aagcagtggc tgcaggagat 121 tgaccgccat gccagcgaga acgtcaataa gctcctggtg //