LOCUS       HSU66622                 160 bp    mRNA    linear   HUM 10-APR-1997
DEFINITION  Human small GTP-binding protein (rab1c) mRNA, partial cds.
ACCESSION   U66622
VERSION     U66622.1
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 160)
  AUTHORS   Chen,D., Guo,J. and Gahl,W.A.
  TITLE     RAB GTPases expressed in human melanoma cells
  JOURNAL   Biochim. Biophys. Acta 1355 (1), 1-6 (1997)
   PUBMED   9030196
REFERENCE   2  (bases 1 to 160)
  AUTHORS   Chen,D. and Gahl,W.A.
  TITLE     Direct Submission
  JOURNAL   Submitted (09-AUG-1996) Human Genetics Branch, NICHD/NIH, 10 Center
            Drive MSC1830, Bethesda, MD 20892-1830, USA
FEATURES             Location/Qualifiers
     source          1..160
                     /db_xref="H-InvDB:HIT000220961"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /cell_type="pigmented melanoma cells"
     gene            1..160
                     /gene="rab1c"
     CDS             <1..>160
                     /gene="rab1c"
                     /codon_start=2
                     /product="small GTP-binding protein"
                     /protein_id="AAC51197.1"
                     /translation="QERFWTITSSYYRGAHGFLVVYDVTDQESYANVKQWLQEIDRHA
                     SENVNKLLV"
BASE COUNT           37 a           45 c           45 g           33 t
ORIGIN      
        1 ccaggaacgg ttctggacca tcacttccag ctactaccgg ggggctcatg gcttcctcgt
       61 ggtatatgac gtcactgacc aggaatccta tgccaacgtg aagcagtggc tgcaggagat
      121 tgaccgccat gccagcgaga acgtcaataa gctcctggtg
//