LOCUS HSU65474 222 bp mRNA linear HUM 26-JUL-2016 DEFINITION Homo sapiens adenylyl cyclase type VI mRNA, partial cds. ACCESSION U65474 VERSION U65474.1 KEYWORDS . SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 222) AUTHORS Raimundo,S., Giray,J., Volff,J.N., Schwab,M., Altenbuchner,J., Ratge,D. and Wisser,H. TITLE Cloning and sequence of partial cDNAs encoding the human type V and VI adenylyl cyclases and subsequent RNA-quantification in various tissues JOURNAL Clin. Chim. Acta 285 (1-2), 155-161 (1999) PUBMED 10481931 REFERENCE 2 (bases 1 to 222) AUTHORS Raimundo,S., Giray,J., Volff,J.-N., Schwab,M., Altenbuchner,J., Ratge,D. and Wisser,H. TITLE Direct Submission JOURNAL Submitted (29-JUL-1996) Robert-Bosch Hospital, Institut fuer Klinische Pharmakologie, Auerbachstrasse 112, Stuttgart 70376, Germany FEATURES Location/Qualifiers source 1..222 /db_xref="H-InvDB:HIT000220880" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /tissue_type="cardiac muscle" CDS <1..>222 /codon_start=1 /product="adenylyl cyclase type VI" /protein_id="AAD00122.1" /translation="LANHMEAGGRAGRIHITRATLQYLNGDYEVEPGRGGERNAYLKE QHIETFLILGASQKRKEEKAMLAKLQRTRA" BASE COUNT 53 a 67 c 75 g 27 t ORIGIN 1 ctggccaacc acatggaggc aggaggccgg gctggccgca tccacatcac tcgggcaaca 61 ctgcagtacc tgaacgggga ctacgaggtg gagccaggcc gtggtggcga gcgcaacgcg 121 tacctcaagg agcagcacat tgagactttc ctcatcctgg gcgccagcca gaaacggaaa 181 gaggagaagg ccatgctggc caagctgcag cggactcggg cc //