LOCUS       HSU65474                 222 bp    mRNA    linear   HUM 26-JUL-2016
DEFINITION  Homo sapiens adenylyl cyclase type VI mRNA, partial cds.
ACCESSION   U65474
VERSION     U65474.1
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 222)
  AUTHORS   Raimundo,S., Giray,J., Volff,J.N., Schwab,M., Altenbuchner,J.,
            Ratge,D. and Wisser,H.
  TITLE     Cloning and sequence of partial cDNAs encoding the human type V and
            VI adenylyl cyclases and subsequent RNA-quantification in various
            tissues
  JOURNAL   Clin. Chim. Acta 285 (1-2), 155-161 (1999)
   PUBMED   10481931
REFERENCE   2  (bases 1 to 222)
  AUTHORS   Raimundo,S., Giray,J., Volff,J.-N., Schwab,M., Altenbuchner,J.,
            Ratge,D. and Wisser,H.
  TITLE     Direct Submission
  JOURNAL   Submitted (29-JUL-1996) Robert-Bosch Hospital, Institut fuer
            Klinische Pharmakologie, Auerbachstrasse 112, Stuttgart 70376,
            Germany
FEATURES             Location/Qualifiers
     source          1..222
                     /db_xref="H-InvDB:HIT000220880"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /tissue_type="cardiac muscle"
     CDS             <1..>222
                     /codon_start=1
                     /product="adenylyl cyclase type VI"
                     /protein_id="AAD00122.1"
                     /translation="LANHMEAGGRAGRIHITRATLQYLNGDYEVEPGRGGERNAYLKE
                     QHIETFLILGASQKRKEEKAMLAKLQRTRA"
BASE COUNT           53 a           67 c           75 g           27 t
ORIGIN      
        1 ctggccaacc acatggaggc aggaggccgg gctggccgca tccacatcac tcgggcaaca
       61 ctgcagtacc tgaacgggga ctacgaggtg gagccaggcc gtggtggcga gcgcaacgcg
      121 tacctcaagg agcagcacat tgagactttc ctcatcctgg gcgccagcca gaaacggaaa
      181 gaggagaagg ccatgctggc caagctgcag cggactcggg cc
//