LOCUS       HSU38658                 355 bp    mRNA    linear   HUM 26-JUL-2016
DEFINITION  Human chromatin structural protein (SPTH6) mRNA, partial cds.
ACCESSION   U38658
VERSION     U38658.1
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 355)
  AUTHORS   Chiang,P.W., Wang,S.Q., Smithivas,P., Song,W.J., Ramamoorthy,S.,
            Hillman,J., Puett,S., Van Keuren,M.L., Crombez,E., Kumar,A.,
            Glover,T.W., Miller,D.E., Tsai,C.H., Blackburn,C.C., Chen,X.N.,
            Sun,Z., Cheng,J.F., Korenberg,J.R. and Kurnit,D.M.
  TITLE     Identification and analysis of the human and murine putative
            chromatin structure regulator SUPT6H and Supt6h
  JOURNAL   Genomics 34 (3), 328-333 (1996)
   PUBMED   8786132
REFERENCE   2  (bases 1 to 355)
  AUTHORS   Chiang,P.-W.
  TITLE     Direct Submission
  JOURNAL   Submitted (15-OCT-1995) Pei-Wen Chiang, Pediatrics, U. of Michigan,
            MSRBI, Rm 3520, 1150 W. Medical Center Drive, Ann Arbor, MI
            48109-0650, USA
FEATURES             Location/Qualifiers
     source          1..355
                     /db_xref="H-InvDB:HIT000219599"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="17"
                     /map="17q11.2"
     gene            1..355
                     /gene="SPTH6"
     CDS             <1..>355
                     /gene="SPTH6"
                     /note="similar to yeast Spt6p and to C. elegans emb-5 gene
                     product"
                     /codon_start=1
                     /product="chromatin structural protein"
                     /protein_id="AAB18949.1"
                     /translation="LSSIGVELVDNELAILYMNSKKSEAEFRDYPPVLRQAVSLARRI
                     QDPLIEFAQVCSSDEDILCLKFHPLQEHVVKEELLNALYCEFINRVNEVGVDVNRAIA
                     HPYSQALIQVCLWPGT"
BASE COUNT           76 a           92 c           98 g           89 t
ORIGIN      
        1 ctgtcatcta ttggggtaga gctggttgac aacgagttgg ccattctcta tatgaacagc
       61 aagaagtcag aggcagagtt ccgggattat cctccagtgc tgagacaggc cgtctccctg
      121 gcccggcgca tccaggaccc tctgattgaa tttgcccagg tgtgcagttc cgatgaagac
      181 atcctgtgtc tcaagtttca ccccttgcag gagcatgtgg tgaaagagga gctgctcaac
      241 gccttgtact gtgaatttat caaccgagtc aatgaggtcg gggtcgatgt caaccgtgcc
      301 attgcccacc cttacagcca ggccttgatc caggtatgtt tgtggcctgg gacct
//