LOCUS HSU38658 355 bp mRNA linear HUM 26-JUL-2016 DEFINITION Human chromatin structural protein (SPTH6) mRNA, partial cds. ACCESSION U38658 VERSION U38658.1 KEYWORDS . SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 355) AUTHORS Chiang,P.W., Wang,S.Q., Smithivas,P., Song,W.J., Ramamoorthy,S., Hillman,J., Puett,S., Van Keuren,M.L., Crombez,E., Kumar,A., Glover,T.W., Miller,D.E., Tsai,C.H., Blackburn,C.C., Chen,X.N., Sun,Z., Cheng,J.F., Korenberg,J.R. and Kurnit,D.M. TITLE Identification and analysis of the human and murine putative chromatin structure regulator SUPT6H and Supt6h JOURNAL Genomics 34 (3), 328-333 (1996) PUBMED 8786132 REFERENCE 2 (bases 1 to 355) AUTHORS Chiang,P.-W. TITLE Direct Submission JOURNAL Submitted (15-OCT-1995) Pei-Wen Chiang, Pediatrics, U. of Michigan, MSRBI, Rm 3520, 1150 W. Medical Center Drive, Ann Arbor, MI 48109-0650, USA FEATURES Location/Qualifiers source 1..355 /db_xref="H-InvDB:HIT000219599" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /chromosome="17" /map="17q11.2" gene 1..355 /gene="SPTH6" CDS <1..>355 /gene="SPTH6" /note="similar to yeast Spt6p and to C. elegans emb-5 gene product" /codon_start=1 /product="chromatin structural protein" /protein_id="AAB18949.1" /translation="LSSIGVELVDNELAILYMNSKKSEAEFRDYPPVLRQAVSLARRI QDPLIEFAQVCSSDEDILCLKFHPLQEHVVKEELLNALYCEFINRVNEVGVDVNRAIA HPYSQALIQVCLWPGT" BASE COUNT 76 a 92 c 98 g 89 t ORIGIN 1 ctgtcatcta ttggggtaga gctggttgac aacgagttgg ccattctcta tatgaacagc 61 aagaagtcag aggcagagtt ccgggattat cctccagtgc tgagacaggc cgtctccctg 121 gcccggcgca tccaggaccc tctgattgaa tttgcccagg tgtgcagttc cgatgaagac 181 atcctgtgtc tcaagtttca ccccttgcag gagcatgtgg tgaaagagga gctgctcaac 241 gccttgtact gtgaatttat caaccgagtc aatgaggtcg gggtcgatgt caaccgtgcc 301 attgcccacc cttacagcca ggccttgatc caggtatgtt tgtggcctgg gacct //