LOCUS HSU34584 923 bp mRNA linear HUM 24-MAR-1996
DEFINITION Human Bcl-2 interacting killer (BIK) mRNA, complete cds.
ACCESSION U34584
VERSION U34584.1
KEYWORDS Bik (Bcl-2 interacting killer); Bcl-2 homology 3 (BH3) domain.
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 26 to 508)
AUTHORS Boyd,J.M., Gallo,G.J., Elangovan,B., Houghton,A.B., Malstrom,S.,
Avery,B.J., Ebb,R.G., Subramanian,T., Chittenden,T., Lutz,R.J. and
Chinnadurai,G.
TITLE Bik, a novel death-inducing protein shares a distinct sequence
motif with Bcl-2 family proteins and interacts with viral and
cellular survival-promoting proteins
JOURNAL Oncogene 11 (9), 1921-1928 (1995)
PUBMED 7478623
REFERENCE 2 (sites)
AUTHORS Chittenden,T., Flemington,C., Houghton,A.B., Ebb,R.G., Gallo,G.J.,
Elangovan,B., Chinnadurai,G. and Lutz,R.J.
TITLE A conserved domain in Bak, distinct from BH1 and BH2, mediates cell
death and protein binding functions
JOURNAL EMBO J. 14 (22), 5589-5596 (1995)
PUBMED 8521816
REFERENCE 3 (bases 1 to 923)
AUTHORS Boyd,J.M. and Chinnadurai,G.
TITLE Direct Submission
JOURNAL Submitted (21-AUG-1995) G. Chinnadurai, Institute for Molecular
Virology, St. Louis University Health Sciences Center, 3681 Park
Avenue, St. Louis, MO 63110, USA
COMMENT On Mar 24, 1996 this sequence version replaced gi:1113096.
FEATURES Location/Qualifiers
source 1..923
/db_xref="H-InvDB:HIT000219380"
/organism="Homo sapiens"
/mol_type="mRNA"
/db_xref="taxon:9606"
/clone_lib="human B-cell library of S. Elledge"
gene 1..923
/gene="BIK"
CDS 26..508
/gene="BIK"
/function="promotes cell death; interacts with Bcl-2
family proteins"
/standard_name="Bcl-2 interacting killer"
/experiment="experimental evidence, no additional details
recorded"
/note="Bik interacts with the survival proteins Bcl-2,
Bcl-xL, EBV-BHRF1 and adenovirus E1B 19kD; This protein is
identical with that described by Robin Brown and
colleagues (personal communication) which is a Human NBK
apoptotic inducer protein, encoded by GenBank Accession
Number X89986"
/codon_start=1
/product="Bik"
/protein_id="AAC50413.1"
/translation="MSEVRPLSRDILMETLLYEQLLEPPTMEVLGMTDSEEDLDPMED
FDSLECMEGSDALALRLACIGDEMDVSLRAPRLAQLSEVAMHSLGLAFIYDQTEDIRD
VLRSFMDGFTTLKENIMRFWRSPNPGSWVSCEQVLLALLLLLALLLPLLSGGLHLLLK
"
misc_feature 206..232
/gene="BIK"
/product="Bcl-2 homology 3 (BH3) domain"
/standard_name="BH3 domain"
/experiment="experimental evidence, no additional details
recorded"
/note="BH3 domain; encodes Bcl-2 homology 3 (BH3) domain;
similar to Bcl-2 family proteins"
/function="promotes cell death; interacts with Bcl-2
family proteins; BH3 domains are required by Bik, as well
as Bak and Bax, to promote apotosis and to interact with
anti-apoptosis members of the Bcl-2 family"
BASE COUNT 189 a 249 c 257 g 228 t
ORIGIN
1 cagcatcgcc gccgccagag gagaaatgtc tgaagtaaga cccctctcca gagacatctt
61 gatggagacc ctcctgtatg agcagctcct ggaacccccg accatggagg ttcttggcat
121 gactgactct gaagaggacc tggaccctat ggaggacttc gattctttgg aatgcatgga
181 gggcagtgac gcattggccc tgcggctggc ctgcatcggg gacgagatgg acgtgagcct
241 cagggccccg cgcctggccc agctctccga ggtggccatg cacagcctgg gtctggcttt
301 catctacgac cagactgagg acatcaggga tgttcttaga agtttcatgg acggtttcac
361 cacacttaag gagaacataa tgaggttctg gagatccccg aaccccgggt cctgggtgtc
421 ctgcgaacag gtgctgctgg cgctgctgct gctgctggcg ctgctgctgc cgctgctcag
481 cgggggcctg cacctgctgc tcaagtgagc ccccggcggc tcaggcgtgg ctggccccac
541 ccccatgacc actgccctga ggtggcggcc tgctgctgtt atctttttaa ctgttttctc
601 atgatgcctt ttatattaac cccgtgatag tgctggaaca ctgctgaggt tttatactca
661 ggttttttgt ttttttttta ttccagtttt cgttttttct aaaagatgaa ttcctatggc
721 tctgcaattg tcaccggtta actgtggcct gtgcccagga agagccattc actcctgccc
781 ctgcccacac ggcaggtagc agggggagtg ctggtcacac ccctgtgtga tatgtgatgc
841 cctcggcaaa gaatctactg gaatagattc cgaggagcag gagtgctcaa taaaatgttg
901 gtttccagca aaaaaaaaaa aaa
//