LOCUS       HSU30829                1111 bp    mRNA    linear   HUM 29-MAR-1996
DEFINITION  Human splicing factor SRp55-3 (SRp55) mRNA, partial cds.
ACCESSION   U30829
VERSION     U30829.1
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1111)
  AUTHORS   Screaton,G.R., Caceres,J.F., Mayeda,A., Bell,M.V., Plebanski,M.,
            Jackson,D.G., Bell,J.I. and Krainer,A.R.
  TITLE     Identification and characterization of three members of the human
            SR family of pre-mRNA splicing factors
  JOURNAL   EMBO J. 14 (17), 4336-4349 (1995)
   PUBMED   7556075
REFERENCE   2  (bases 1 to 1111)
  AUTHORS   Screaton,G.R.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-JUL-1995) Gavin R. Screaton, Immunology Group
            Nuffield Dept. of Medicine, Institute of Molecular Medicine, John
            Radcliffe Hospital, Headington, Oxford 0X3 9DU, United Kingdom
FEATURES             Location/Qualifiers
     source          1..1111
                     /db_xref="H-InvDB:HIT000219108"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="3"
                     /cell_line="HT-29 carcinoma"
                     /tissue_type="colon"
     gene            106..1111
                     /gene="SRp55"
     CDS             106..>1111
                     /gene="SRp55"
                     /function="splicing factor"
                     /note="member of the family of SR protein pre-mRNA
                     splicing factors; alternatively spliced"
                     /codon_start=1
                     /product="SRp55-3"
                     /protein_id="AAA93072.1"
                     /translation="MPRVYIGRLSYNVREKDIQRFFSGYGRLLEVDLKNGYGFVEFED
                     SRDADDAVYELNGKELCGEHVIVEHARGPRRDRDGYSYGSRSGGGGYSSRRTSGRDKY
                     GPPVRTEYRLIVENLSSRCSWQDLKDFMRQAGEVTYADAHKERTNEGVIEFRSYSDMK
                     RALDKLDGTEINGRNIRLIEDKPRTSHRRSYSGSRSRSRSRRRSRSRSRRSSRSRSRS
                     ISKSRSRSRSRSKGRSRSRSKGRKSRSKSKSKPKSDRGSHSHSRSRSKDEYEKSRSRS
                     RSRSPKENGKGDIKSKSRSRSQSRSNSPLPVPPSKALKLGARFMSQQGTESLYSLASS
                     C"
     gene            1042..1111
                     /gene="SRp55-3"
     misc_feature    1042..1111
                     /gene="SRp55-3"
                     /note="alternative 3' sequence encodes 24 novel amino
                     acids when compared to SRp55-1 encoded by GenBank
                     Accession Number U30833; the termiation codon is not
                     present in this partial clone"
BASE COUNT          296 a          293 c          306 g          216 t
ORIGIN      
        1 gtgaggcgcg tgttcgggct cttgccgtcc ccgcacccgc accgcgttac tggcttgcgg
       61 tccgccgttc gacaaccagc ccttgggtcc ccgcccgcca cggacatgcc gcgcgtctac
      121 ataggacgcc tgagctacaa cgtccgggag aaggacatcc agcgcttttt cagtggctat
      181 ggccgcctcc tcgaagtaga cctcaaaaat gggtacggct tcgtggagtt cgaggactcc
      241 cgcgacgccg acgacgccgt ttacgagctg aacggcaagg agctctgcgg cgagcacgtg
      301 atcgtagagc acgcccgggg cccgcgtcgc gatcgcgacg gctacagcta cggaagccgc
      361 agtggtggag gtggatacag cagtcggaga acatctggca gagacaaata cggaccacct
      421 gttcgtacag aatacaggct tattgtagaa aatctttcta gtcggtgcag ttggcaagat
      481 ttaaaggatt ttatgcgaca agcaggtgaa gtaacctatg cggatgccca caaggaacga
      541 acaaatgagg gtgtaattga gtttcgctcc tactctgaca tgaagcgtgc tttggacaaa
      601 ctggatggca cagaaataaa tggcagaaat attaggctta ttgaagataa gccacgcaca
      661 agccataggc gatcttactc tggaagcaga tccaggtctc gatctagaag acggtcacga
      721 agtaggagtc gcaggagcag ccgcagtaga tctcgaagta tctcaaaaag tcgctcccgt
      781 tccaggtcgc ggagcaaagg tcgatcacgt tctcgatcaa aaggcaggaa atctagatca
      841 aagagcaaat ctaagcccaa gtctgatcgg ggctcccatt cacattctcg aagcagatct
      901 aaggatgagt atgagaaatc tcgaagcagg tctcggtccc gatcccccaa agaaaatgga
      961 aagggtgata taaagtcaaa atccagatca aggagccagt cccgttccaa ttcgccgcta
     1021 cctgttccac cctcaaaggc cctgaagctc ggagccagat tcatgagtca gcaaggaact
     1081 gagagccttt acagtctggc atcaagctgc c
//