LOCUS HSU30829 1111 bp mRNA linear HUM 29-MAR-1996 DEFINITION Human splicing factor SRp55-3 (SRp55) mRNA, partial cds. ACCESSION U30829 VERSION U30829.1 KEYWORDS . SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 1111) AUTHORS Screaton,G.R., Caceres,J.F., Mayeda,A., Bell,M.V., Plebanski,M., Jackson,D.G., Bell,J.I. and Krainer,A.R. TITLE Identification and characterization of three members of the human SR family of pre-mRNA splicing factors JOURNAL EMBO J. 14 (17), 4336-4349 (1995) PUBMED 7556075 REFERENCE 2 (bases 1 to 1111) AUTHORS Screaton,G.R. TITLE Direct Submission JOURNAL Submitted (03-JUL-1995) Gavin R. Screaton, Immunology Group Nuffield Dept. of Medicine, Institute of Molecular Medicine, John Radcliffe Hospital, Headington, Oxford 0X3 9DU, United Kingdom FEATURES Location/Qualifiers source 1..1111 /db_xref="H-InvDB:HIT000219108" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /clone="3" /cell_line="HT-29 carcinoma" /tissue_type="colon" gene 106..1111 /gene="SRp55" CDS 106..>1111 /gene="SRp55" /function="splicing factor" /note="member of the family of SR protein pre-mRNA splicing factors; alternatively spliced" /codon_start=1 /product="SRp55-3" /protein_id="AAA93072.1" /translation="MPRVYIGRLSYNVREKDIQRFFSGYGRLLEVDLKNGYGFVEFED SRDADDAVYELNGKELCGEHVIVEHARGPRRDRDGYSYGSRSGGGGYSSRRTSGRDKY GPPVRTEYRLIVENLSSRCSWQDLKDFMRQAGEVTYADAHKERTNEGVIEFRSYSDMK RALDKLDGTEINGRNIRLIEDKPRTSHRRSYSGSRSRSRSRRRSRSRSRRSSRSRSRS ISKSRSRSRSRSKGRSRSRSKGRKSRSKSKSKPKSDRGSHSHSRSRSKDEYEKSRSRS RSRSPKENGKGDIKSKSRSRSQSRSNSPLPVPPSKALKLGARFMSQQGTESLYSLASS C" gene 1042..1111 /gene="SRp55-3" misc_feature 1042..1111 /gene="SRp55-3" /note="alternative 3' sequence encodes 24 novel amino acids when compared to SRp55-1 encoded by GenBank Accession Number U30833; the termiation codon is not present in this partial clone" BASE COUNT 296 a 293 c 306 g 216 t ORIGIN 1 gtgaggcgcg tgttcgggct cttgccgtcc ccgcacccgc accgcgttac tggcttgcgg 61 tccgccgttc gacaaccagc ccttgggtcc ccgcccgcca cggacatgcc gcgcgtctac 121 ataggacgcc tgagctacaa cgtccgggag aaggacatcc agcgcttttt cagtggctat 181 ggccgcctcc tcgaagtaga cctcaaaaat gggtacggct tcgtggagtt cgaggactcc 241 cgcgacgccg acgacgccgt ttacgagctg aacggcaagg agctctgcgg cgagcacgtg 301 atcgtagagc acgcccgggg cccgcgtcgc gatcgcgacg gctacagcta cggaagccgc 361 agtggtggag gtggatacag cagtcggaga acatctggca gagacaaata cggaccacct 421 gttcgtacag aatacaggct tattgtagaa aatctttcta gtcggtgcag ttggcaagat 481 ttaaaggatt ttatgcgaca agcaggtgaa gtaacctatg cggatgccca caaggaacga 541 acaaatgagg gtgtaattga gtttcgctcc tactctgaca tgaagcgtgc tttggacaaa 601 ctggatggca cagaaataaa tggcagaaat attaggctta ttgaagataa gccacgcaca 661 agccataggc gatcttactc tggaagcaga tccaggtctc gatctagaag acggtcacga 721 agtaggagtc gcaggagcag ccgcagtaga tctcgaagta tctcaaaaag tcgctcccgt 781 tccaggtcgc ggagcaaagg tcgatcacgt tctcgatcaa aaggcaggaa atctagatca 841 aagagcaaat ctaagcccaa gtctgatcgg ggctcccatt cacattctcg aagcagatct 901 aaggatgagt atgagaaatc tcgaagcagg tctcggtccc gatcccccaa agaaaatgga 961 aagggtgata taaagtcaaa atccagatca aggagccagt cccgttccaa ttcgccgcta 1021 cctgttccac cctcaaaggc cctgaagctc ggagccagat tcatgagtca gcaaggaact 1081 gagagccttt acagtctggc atcaagctgc c //