LOCUS HSU19970 590 bp mRNA linear HUM 09-AUG-1995 DEFINITION Human antimicrobial LPS-binding protein CAP18 precursor mRNA, complete cds. ACCESSION U19970 VERSION U19970.1 KEYWORDS . SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 590) AUTHORS Larrick,J.W., Hirata,M., Balint,R.F., Lee,J., Zhong,J. and Wright,S.C. TITLE Human CAP18: a novel antimicrobial lipopolysaccharide-binding protein JOURNAL Infect. Immun. 63 (4), 1291-1297 (1995) PUBMED 7890387 REFERENCE 2 (bases 1 to 590) AUTHORS Balint,R.F. TITLE Direct Submission JOURNAL Submitted (18-JAN-1995) Robert F. Balint, Palo Alto Institute of Molecular Medicine, 2462 Wyandotte Street, Mountain View, CA 94043, USA FEATURES Location/Qualifiers source 1..590 /db_xref="H-InvDB:HIT000218541" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /tissue_type="bone marrow" /dev_stage="adult" CDS 16..528 /function="antimicrobial LPS-binding protein" /experiment="experimental evidence, no additional details recorded" /codon_start=1 /product="CAP18 precursor" /protein_id="AAA74084.1" /translation="MKTQRDGHSLGRWSLVLLLLGLVMPLAIIAQVLSYKEAVLRAID GINQRSSDANLYRLLDLDPRPTMDGDPDTPKPVSFTVKETVCPRTTQQSPEDCDFKKD GLVKRCMGTVTLNQARGSFDISCDKDNKRFALLGDFFRKSKEKIGKEFKRIVQRIKDF LRNLVPRTES" sig_peptide 16..105 mat_peptide 106..525 /product="Holo-CAP18" /function="antimicrobial LPS-binding protein" /experiment="experimental evidence, no additional details recorded" misc_feature 106..414 /product="conserved N-terminal domain" /experiment="experimental evidence, no additional details recorded" /function="unknown" misc_feature 415..525 /product="non-conserved C-terminal domain" /experiment="experimental evidence, no additional details recorded" /function="antimicrobial LPS-binding domain" polyA_site 590 /note="9 A nucleotides" BASE COUNT 146 a 148 c 171 g 125 t ORIGIN 1 gcagacatgg ggaccatgaa gacccaaagg gatggccact ccctggggcg gtggtcactg 61 gtgctcctgc tgctgggcct ggtgatgcct ctggccatca ttgcccaggt cctcagctac 121 aaggaagctg tgcttcgtgc tatagatggc atcaaccagc ggtcctcgga tgctaacctc 181 taccgcctcc tggacctgga ccccaggccc acgatggatg gggacccaga cacgccaaag 241 cctgtgagct tcacagtgaa ggagacagtg tgccccagga cgacacagca gtcaccagag 301 gattgtgact tcaagaagga cgggctggtg aagcggtgta tggggacagt gaccctcaac 361 caggccaggg gctcctttga catcagttgt gataaggata acaagagatt tgccctgctg 421 ggtgatttct tccggaaatc taaagagaag attggcaaag agtttaaaag aattgtccag 481 agaatcaagg attttttgcg gaatcttgta cccaggacag agtcctagtg tgtgccctac 541 cctggctcag gcttctgggc tctgagaaat aaactatgag agcaatttca //