LOCUS HSU19796 809 bp mRNA linear HUM 22-AUG-1995 DEFINITION Human melanoma antigen p15 mRNA, complete cds. ACCESSION U19796 VERSION U19796.1 KEYWORDS . SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 809) AUTHORS Robbins,P.F., el-Gamil,M., Li,Y.F., Topalian,S.L., Rivoltini,L., Sakaguchi,K., Appella,E., Kawakami,Y. and Rosenberg,S.A. TITLE Cloning of a new gene encoding an antigen recognized by melanoma-specific HLA-A24-restricted tumor-infiltrating lymphocytes JOURNAL J. Immunol. 154 (11), 5944-5950 (1995) PUBMED 7751637 REFERENCE 2 (bases 1 to 809) AUTHORS Robbins,P.F. TITLE Direct Submission JOURNAL Submitted (12-JAN-1995) Paul F. Robbins, Surgery Branch/NCI, NIH, Building 10 Room 2B42, 10 Center Dr., Bethesda, MD 20882-1502, USA FEATURES Location/Qualifiers source 1..809 /db_xref="H-InvDB:HIT000218529" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /cell_line="888 mel" /cell_type="melanoma" CDS 145..531 /codon_start=1 /product="melanoma antigen p15" /protein_id="AAC50181.1" /translation="MRTLDLIDEAYGLDFYILKTPKEDLCSKFGMELKRGMLLRLARQ DPQLHPEDPERRAAIYDKYKEFAIPEEEAEWVGLTLEEAIEKQRLLEEKDPVPLFKIY VAELIQQLQQQALSEPAVVQKTASGQ" BASE COUNT 171 a 231 c 268 g 139 t ORIGIN 1 agcggcgagg gctggatcct gggccaaata tatgccaaca acgacaagct ctccaagagg 61 ctgaagaaag tgtggaagcc acagctgttt gagcgagagt tctacagtga gatcctggac 121 aagaagttca cagtgactgt gaccatgcgg accctggacc tcatcgatga ggcttacggg 181 ctcgactttt acatcctcaa gaccccgaag gaggacctgt gctccaagtt tgggatggag 241 ctgaagcgag ggatgctgct gcggcttgcc cggcaggacc cccagctgca ccccgaggac 301 cccgagcggc gggcagccat ctacgacaag tacaaggaat ttgccatccc agaggaggag 361 gcagagtggg tgggcctcac gctggaggag gccattgaga agcagagact tttggaggag 421 aaggaccctg tacccctgtt caagatctat gtggcggagc tgatccagca gctgcagcag 481 caggcactgt cagagccggc ggtggtgcag aagacagcca gtggccagtg accacacagc 541 tcctccatgc ctgaccaaca ggcccagctt tccctgccag gccctttgca ctgaggacac 601 agatcccggg gagctgtgag ggccaccggt gggcagtggg tggatcctgg tttcgtgtgc 661 tgcccatgca ccttccagcc cggggccagc ttggcaggga tccccaggag gcctgggccg 721 cccagaggct cctctcaggc tgggccccga cgtttgcggc agtgttcctt gtcccgtggg 781 gccgggagcg agtaaagtct gggccaggc //