LOCUS       HSU19796                 809 bp    mRNA    linear   HUM 22-AUG-1995
DEFINITION  Human melanoma antigen p15 mRNA, complete cds.
ACCESSION   U19796
VERSION     U19796.1
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 809)
  AUTHORS   Robbins,P.F., el-Gamil,M., Li,Y.F., Topalian,S.L., Rivoltini,L.,
            Sakaguchi,K., Appella,E., Kawakami,Y. and Rosenberg,S.A.
  TITLE     Cloning of a new gene encoding an antigen recognized by
            melanoma-specific HLA-A24-restricted tumor-infiltrating lymphocytes
  JOURNAL   J. Immunol. 154 (11), 5944-5950 (1995)
   PUBMED   7751637
REFERENCE   2  (bases 1 to 809)
  AUTHORS   Robbins,P.F.
  TITLE     Direct Submission
  JOURNAL   Submitted (12-JAN-1995) Paul F. Robbins, Surgery Branch/NCI, NIH,
            Building 10 Room 2B42, 10 Center Dr., Bethesda, MD 20882-1502, USA
FEATURES             Location/Qualifiers
     source          1..809
                     /db_xref="H-InvDB:HIT000218529"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /cell_line="888 mel"
                     /cell_type="melanoma"
     CDS             145..531
                     /codon_start=1
                     /product="melanoma antigen p15"
                     /protein_id="AAC50181.1"
                     /translation="MRTLDLIDEAYGLDFYILKTPKEDLCSKFGMELKRGMLLRLARQ
                     DPQLHPEDPERRAAIYDKYKEFAIPEEEAEWVGLTLEEAIEKQRLLEEKDPVPLFKIY
                     VAELIQQLQQQALSEPAVVQKTASGQ"
BASE COUNT          171 a          231 c          268 g          139 t
ORIGIN      
        1 agcggcgagg gctggatcct gggccaaata tatgccaaca acgacaagct ctccaagagg
       61 ctgaagaaag tgtggaagcc acagctgttt gagcgagagt tctacagtga gatcctggac
      121 aagaagttca cagtgactgt gaccatgcgg accctggacc tcatcgatga ggcttacggg
      181 ctcgactttt acatcctcaa gaccccgaag gaggacctgt gctccaagtt tgggatggag
      241 ctgaagcgag ggatgctgct gcggcttgcc cggcaggacc cccagctgca ccccgaggac
      301 cccgagcggc gggcagccat ctacgacaag tacaaggaat ttgccatccc agaggaggag
      361 gcagagtggg tgggcctcac gctggaggag gccattgaga agcagagact tttggaggag
      421 aaggaccctg tacccctgtt caagatctat gtggcggagc tgatccagca gctgcagcag
      481 caggcactgt cagagccggc ggtggtgcag aagacagcca gtggccagtg accacacagc
      541 tcctccatgc ctgaccaaca ggcccagctt tccctgccag gccctttgca ctgaggacac
      601 agatcccggg gagctgtgag ggccaccggt gggcagtggg tggatcctgg tttcgtgtgc
      661 tgcccatgca ccttccagcc cggggccagc ttggcaggga tccccaggag gcctgggccg
      721 cccagaggct cctctcaggc tgggccccga cgtttgcggc agtgttcctt gtcccgtggg
      781 gccgggagcg agtaaagtct gggccaggc
//