LOCUS       HSU15085                1362 bp    mRNA    linear   HUM 05-JAN-1996
DEFINITION  Human HLA-DMB mRNA, complete cds.
ACCESSION   U15085
VERSION     U15085.1
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1362)
  AUTHORS   Shaman,J., von Scheven,E., Morris,P., Chang,M.D. and Mellins,E.
  TITLE     Analysis of HLA-DMB mutants and -DMB genomic structure
  JOURNAL   Immunogenetics 41 (2-3), 117-124 (1995)
   PUBMED   7528727
REFERENCE   2  (bases 66 to 1362)
  AUTHORS   Kelly,A.P., Monaco,J.J., Cho,S.G. and Trowsdale,J.
  TITLE     A new human HLA class II-related locus, DM
  JOURNAL   Nature 353 (6344), 571-573 (1991)
   PUBMED   1922365
REFERENCE   3  (bases 1 to 1362)
  AUTHORS   Mellins,E.D.
  TITLE     Direct Submission
  JOURNAL   Submitted (23-SEP-1994) Elizabeth D Mellins, Rheumatology,
            Children's Hospital of Philadelphia, 34th and Civic Center Blvd,
            Room 8118, Philadelphia, PA 19104, USA
FEATURES             Location/Qualifiers
     source          1..1362
                     /db_xref="H-InvDB:HIT000218295_04"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="6"
                     /sex="female"
                     /cell_type="EBV transformed B-lymphocyte"
                     /tissue_type="blood"
     misc_feature    66
                     /note="previously published sequence notes an alternative
                     transcription start site here"
                     /citation=[2]
     CDS             234..1025
                     /codon_start=1
                     /product="HLA-DMB"
                     /protein_id="AAB60387.1"
                     /translation="MITFLPLLLGLSLGCTGAGGFVAHVESTCLLDDAGTPKDFTYCI
                     SFNKDLLTCWDPEENKMAPCEFGVLNSLANVLSQHLNQKDTLMQRLRNGLQNCATHTQ
                     PFWGSLTNRTRPPSVQVAKTTPFNTREPVMLACYVWGFYPAEVTITWRKNGKLVMPHS
                     SAHKTAQPNGDWTYQTLSHLALTPSYGDTYTCVVEHIGAPEPILRDWTPGLSPMQTLK
                     VSVSAVTLGLGLIIFSLGVISWRRAGHSSYTPLPGSNYSEGWHIS"
     variation       585
                     /note="point mutation generates a 5' concensus splice
                     sequence in exon 3 which results in the loss of the
                     remainder of exon 3 and a frameshift of the distal (3')
                     sequence; lab induced with ethyl methane sulfonate; mutant
                     cell 7.19.6"
                     /replace="t"
     variation       854
                     /note="point mutation converts a trytophan to a stop codon
                     at the 3' end of exon 3 and loss of exon 4 during
                     splicing, exons 5 and 6 remain intact; lab induced with
                     ethyl methane sulfonate; mutant cell 10.6.6"
                     /replace="a"
     variation       854
                     /note="point mutation converts a trytophan to a stop codon
                     at the 3' end of exon 3 and loss of exon 4 during
                     splicing, exons 5 and 6 remain intact; lab induced with
                     ethyl methane sulfonate; mutant cell 10.78.6"
                     /replace="a"
BASE COUNT          323 a          367 c          347 g          325 t
ORIGIN      
        1 cctgtttggg acactggact cccgtgagct ggaaggaaca gatttaatat ctaggggctg
       61 ggtatcccca catcactcat ttggggggtc aagggacccg ggcaatatag tattctgctc
      121 agtgtctgga gatcatctac ccaggctggg gcttctggga caggcgagga cccacggacc
      181 ctggaagagc tggtccaggg gactgaactc ccggcatctt tacagagcag agcatgatca
      241 cattcctgcc gctgctgctg gggctcagcc tgggctgcac aggagcaggt ggcttcgtgg
      301 cccatgtgga aagcacctgt ctgttggatg atgctgggac tccaaaggat ttcacatact
      361 gcatctcctt caacaaggat ctgctgacct gctgggatcc agaggagaat aagatggccc
      421 cttgcgaatt tggggtgctg aatagcttgg cgaatgtcct ctcacagcac ctcaaccaaa
      481 aagacaccct gatgcagcgc ttgcgcaatg ggcttcagaa ttgtgccaca cacacccagc
      541 ccttctgggg atcactgacc aacaggacac ggccaccatc tgtgcaagta gccaaaacca
      601 ctccttttaa cacgagggag cctgtgatgc tggcctgcta tgtgtggggc ttctatccag
      661 cagaagtgac tatcacgtgg aggaagaacg ggaagcttgt catgcctcac agcagtgcgc
      721 acaagactgc ccagcccaat ggagactgga cataccagac cctctcccat ttagccttaa
      781 ccccctctta cggggacact tacacctgtg tggtagagca cattggggct cctgagccca
      841 tccttcggga ctggacacct gggctgtccc ccatgcagac cctgaaggtt tctgtgtctg
      901 cagtgactct gggcctgggc ctcatcatct tctctcttgg tgtgatcagc tggcggagag
      961 ctggccactc tagttacact cctcttcctg ggtccaatta ttcagaagga tggcacattt
     1021 cctagaggca gaatcctaca acttccactc caagtgagaa ggagattcaa actcaatgat
     1081 gctaccatgc ctctccaaca tcttcaaccc cctgacatta tcttggatcc tatggtttct
     1141 ccatccaatt ctttgaattt cccagtctcc cctatgtaaa acttagcaac ttgggggacc
     1201 tcattcctgg gactatgctg taaccaaatt attgtccaag gctatatttc tgggatgaat
     1261 ataatctgag gaagggagtt aaagaccctc ctggggctct cagtgtgcca tagaggacag
     1321 caactggtga ttgtttcaga gaaataaact ttggtggaaa aa
//