LOCUS HSU15085 1362 bp mRNA linear HUM 05-JAN-1996 DEFINITION Human HLA-DMB mRNA, complete cds. ACCESSION U15085 VERSION U15085.1 KEYWORDS . SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 1362) AUTHORS Shaman,J., von Scheven,E., Morris,P., Chang,M.D. and Mellins,E. TITLE Analysis of HLA-DMB mutants and -DMB genomic structure JOURNAL Immunogenetics 41 (2-3), 117-124 (1995) PUBMED 7528727 REFERENCE 2 (bases 66 to 1362) AUTHORS Kelly,A.P., Monaco,J.J., Cho,S.G. and Trowsdale,J. TITLE A new human HLA class II-related locus, DM JOURNAL Nature 353 (6344), 571-573 (1991) PUBMED 1922365 REFERENCE 3 (bases 1 to 1362) AUTHORS Mellins,E.D. TITLE Direct Submission JOURNAL Submitted (23-SEP-1994) Elizabeth D Mellins, Rheumatology, Children's Hospital of Philadelphia, 34th and Civic Center Blvd, Room 8118, Philadelphia, PA 19104, USA FEATURES Location/Qualifiers source 1..1362 /db_xref="H-InvDB:HIT000218295_04" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /chromosome="6" /sex="female" /cell_type="EBV transformed B-lymphocyte" /tissue_type="blood" misc_feature 66 /note="previously published sequence notes an alternative transcription start site here" /citation=[2] CDS 234..1025 /codon_start=1 /product="HLA-DMB" /protein_id="AAB60387.1" /translation="MITFLPLLLGLSLGCTGAGGFVAHVESTCLLDDAGTPKDFTYCI SFNKDLLTCWDPEENKMAPCEFGVLNSLANVLSQHLNQKDTLMQRLRNGLQNCATHTQ PFWGSLTNRTRPPSVQVAKTTPFNTREPVMLACYVWGFYPAEVTITWRKNGKLVMPHS SAHKTAQPNGDWTYQTLSHLALTPSYGDTYTCVVEHIGAPEPILRDWTPGLSPMQTLK VSVSAVTLGLGLIIFSLGVISWRRAGHSSYTPLPGSNYSEGWHIS" variation 585 /note="point mutation generates a 5' concensus splice sequence in exon 3 which results in the loss of the remainder of exon 3 and a frameshift of the distal (3') sequence; lab induced with ethyl methane sulfonate; mutant cell 7.19.6" /replace="t" variation 854 /note="point mutation converts a trytophan to a stop codon at the 3' end of exon 3 and loss of exon 4 during splicing, exons 5 and 6 remain intact; lab induced with ethyl methane sulfonate; mutant cell 10.6.6" /replace="a" variation 854 /note="point mutation converts a trytophan to a stop codon at the 3' end of exon 3 and loss of exon 4 during splicing, exons 5 and 6 remain intact; lab induced with ethyl methane sulfonate; mutant cell 10.78.6" /replace="a" BASE COUNT 323 a 367 c 347 g 325 t ORIGIN 1 cctgtttggg acactggact cccgtgagct ggaaggaaca gatttaatat ctaggggctg 61 ggtatcccca catcactcat ttggggggtc aagggacccg ggcaatatag tattctgctc 121 agtgtctgga gatcatctac ccaggctggg gcttctggga caggcgagga cccacggacc 181 ctggaagagc tggtccaggg gactgaactc ccggcatctt tacagagcag agcatgatca 241 cattcctgcc gctgctgctg gggctcagcc tgggctgcac aggagcaggt ggcttcgtgg 301 cccatgtgga aagcacctgt ctgttggatg atgctgggac tccaaaggat ttcacatact 361 gcatctcctt caacaaggat ctgctgacct gctgggatcc agaggagaat aagatggccc 421 cttgcgaatt tggggtgctg aatagcttgg cgaatgtcct ctcacagcac ctcaaccaaa 481 aagacaccct gatgcagcgc ttgcgcaatg ggcttcagaa ttgtgccaca cacacccagc 541 ccttctgggg atcactgacc aacaggacac ggccaccatc tgtgcaagta gccaaaacca 601 ctccttttaa cacgagggag cctgtgatgc tggcctgcta tgtgtggggc ttctatccag 661 cagaagtgac tatcacgtgg aggaagaacg ggaagcttgt catgcctcac agcagtgcgc 721 acaagactgc ccagcccaat ggagactgga cataccagac cctctcccat ttagccttaa 781 ccccctctta cggggacact tacacctgtg tggtagagca cattggggct cctgagccca 841 tccttcggga ctggacacct gggctgtccc ccatgcagac cctgaaggtt tctgtgtctg 901 cagtgactct gggcctgggc ctcatcatct tctctcttgg tgtgatcagc tggcggagag 961 ctggccactc tagttacact cctcttcctg ggtccaatta ttcagaagga tggcacattt 1021 cctagaggca gaatcctaca acttccactc caagtgagaa ggagattcaa actcaatgat 1081 gctaccatgc ctctccaaca tcttcaaccc cctgacatta tcttggatcc tatggtttct 1141 ccatccaatt ctttgaattt cccagtctcc cctatgtaaa acttagcaac ttgggggacc 1201 tcattcctgg gactatgctg taaccaaatt attgtccaag gctatatttc tgggatgaat 1261 ataatctgag gaagggagtt aaagaccctc ctggggctct cagtgtgcca tagaggacag 1321 caactggtga ttgtttcaga gaaataaact ttggtggaaa aa //