LOCUS       HSU13831                 405 bp    mRNA    linear   HUM 21-JUL-1995
DEFINITION  Human cellular retinol binding protein II (CRBPII) mRNA, complete
            cds.
ACCESSION   U13831
VERSION     U13831.1
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 405)
  AUTHORS   Loughney,A.D., Kumarendran,M.K., Thomas,E.J. and Redfern,C.P.
  TITLE     Variation in the expression of cellular retinoid binding proteins
            in human endometrium throughout the menstrual cycle
  JOURNAL   Hum. Reprod. 10 (5), 1297-1304 (1995)
   PUBMED   7657783
REFERENCE   2  (bases 1 to 405)
  AUTHORS   Redfern,C.P.
  TITLE     Direct Submission
  JOURNAL   Submitted (19-AUG-1994) Christopher P. Redfern, Medical Molecular
            Biology Group, University of Newcastle Medical School, Framlington
            Place, Newcastle upon Tyne, Ne2 4Hh, United Kingdom
FEATURES             Location/Qualifiers
     source          1..405
                     /db_xref="H-InvDB:HIT000218151"
                     /organism="Homo sapiens"
                     /macronuclear
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="pHCRBP2"
                     /cell_line="Caco-2"
     gene            1..405
                     /gene="CRBPII"
     CDS             1..405
                     /gene="CRBPII"
                     /function="cytoplasmic binding protein for retinol in
                     enterocytes"
                     /codon_start=1
                     /product="cellular retinol binding protein II"
                     /protein_id="AAC50162.1"
                     /translation="MTRDQNGTWEMESNENFEGYMKALDIDFATPKIAVRLTQTKVID
                     QDGDNFKTKTTSTFRNYDVDFTVGVEFDEYTKSLDNRHVKALVTWEGDVLVCVQKGEK
                     ENRGWKQWIEGDKLYLELTCGDQVCRQVFKKK"
     primer_bind     1..20
                     /note="5' PCR amplification primer"
     primer_bind     complement(385..405)
                     /note="3' PCR amplification primer"
BASE COUNT          119 a           74 c          124 g           88 t
ORIGIN      
        1 atgacgaggg accagaatgg aacctgggag atggagagta atgaaaactt tgagggctac
       61 atgaaggccc tggatattga ttttgccacc cccaagattg cagtacgtct tactcagacg
      121 aaggttattg atcaagatgg tgataacttc aagacaaaaa ccactagcac attccgcaac
      181 tatgatgtgg atttcactgt tggagtagag tttgacgagt acacaaagag cctggacaac
      241 cggcatgtta aggcactggt cacctgggaa ggtgatgtcc ttgtgtgtgt gcaaaagggg
      301 gagaaggaga accgcggctg gaagcagtgg attgaggggg acaagctgta cctggagctg
      361 acctgtggtg accaggtgtg ccgtcaagtg ttcaaaaaga agtga
//