LOCUS HSU13831 405 bp mRNA linear HUM 21-JUL-1995 DEFINITION Human cellular retinol binding protein II (CRBPII) mRNA, complete cds. ACCESSION U13831 VERSION U13831.1 KEYWORDS . SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 405) AUTHORS Loughney,A.D., Kumarendran,M.K., Thomas,E.J. and Redfern,C.P. TITLE Variation in the expression of cellular retinoid binding proteins in human endometrium throughout the menstrual cycle JOURNAL Hum. Reprod. 10 (5), 1297-1304 (1995) PUBMED 7657783 REFERENCE 2 (bases 1 to 405) AUTHORS Redfern,C.P. TITLE Direct Submission JOURNAL Submitted (19-AUG-1994) Christopher P. Redfern, Medical Molecular Biology Group, University of Newcastle Medical School, Framlington Place, Newcastle upon Tyne, Ne2 4Hh, United Kingdom FEATURES Location/Qualifiers source 1..405 /db_xref="H-InvDB:HIT000218151" /organism="Homo sapiens" /macronuclear /mol_type="mRNA" /db_xref="taxon:9606" /clone="pHCRBP2" /cell_line="Caco-2" gene 1..405 /gene="CRBPII" CDS 1..405 /gene="CRBPII" /function="cytoplasmic binding protein for retinol in enterocytes" /codon_start=1 /product="cellular retinol binding protein II" /protein_id="AAC50162.1" /translation="MTRDQNGTWEMESNENFEGYMKALDIDFATPKIAVRLTQTKVID QDGDNFKTKTTSTFRNYDVDFTVGVEFDEYTKSLDNRHVKALVTWEGDVLVCVQKGEK ENRGWKQWIEGDKLYLELTCGDQVCRQVFKKK" primer_bind 1..20 /note="5' PCR amplification primer" primer_bind complement(385..405) /note="3' PCR amplification primer" BASE COUNT 119 a 74 c 124 g 88 t ORIGIN 1 atgacgaggg accagaatgg aacctgggag atggagagta atgaaaactt tgagggctac 61 atgaaggccc tggatattga ttttgccacc cccaagattg cagtacgtct tactcagacg 121 aaggttattg atcaagatgg tgataacttc aagacaaaaa ccactagcac attccgcaac 181 tatgatgtgg atttcactgt tggagtagag tttgacgagt acacaaagag cctggacaac 241 cggcatgtta aggcactggt cacctgggaa ggtgatgtcc ttgtgtgtgt gcaaaagggg 301 gagaaggaga accgcggctg gaagcagtgg attgaggggg acaagctgta cctggagctg 361 acctgtggtg accaggtgtg ccgtcaagtg ttcaaaaaga agtga //