LOCUS S83549 595 bp mRNA linear HUM 26-JUL-2016 DEFINITION Na+/H+ exchanger isoform NHE-2 [human, various tissues, mRNA Partial, 595 nt]. ACCESSION S83549 VERSION S83549.1 KEYWORDS . SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 595) AUTHORS Dudeja,P.K., Rao,D.D., Syed,I., Joshi,V., Dahdal,R.Y., Gardner,C., Risk,M.C., Schmidt,L., Bavishi,D., Kim,K.E., Harig,J.M., Goldstein,J.L., Layden,T.J. and Ramaswamy,K. TITLE Intestinal distribution of human Na+/H+ exchanger isoforms NHE-1, NHE-2, and NHE-3 mRNA JOURNAL Am. J. Physiol. 271 (3 PT 1), G483-G493 (1996) PUBMED 8843774 REMARK GenBank staff at the National Library of Medicine created this entry [NCBI gibbsq 180443] from the original journal article. FEATURES Location/Qualifiers source 1..595 /db_xref="H-InvDB:HIT000217217" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" gene 1..595 /gene="Na+/H+ exchanger isoform NHE-2" CDS 1..594 /gene="Na+/H+ exchanger isoform NHE-2" /codon_start=1 /product="Na+/H+ exchanger isoform NHE-2" /protein_id="AAB50820.1" /translation="VKTGIEDVCGHWGHNFWRDKFKKFDDKYLRNVLIRENQPKSSIV SLYKKLEIKHAIEMAETGMISTVPTFASLNDCREEKIRKVTSSETDEIRELLSRNLYQ IRQRTLSYNRHSLTADTSERQAKEILIRRRHSLRESIRKDSSLNREHRASTSTSRYLS LPKNTKLPEKLQKRRTISIADGNSSSSDAHAGTTVLNL" BASE COUNT 204 a 117 c 132 g 142 t ORIGIN 1 gtgaagactg ggattgaaga tgtttgtgga cattggggtc acaacttttg gagagacaag 61 tttaagaagt ttgatgataa atatctgcgg aacgttttga ttcgggaaaa ccaaccaaag 121 tcaagtattg tatctttata taaaaagctt gaaataaaac atgccattga gatggcagag 181 actgggatga taagtactgt ccctacattt gcatctctaa atgattgtcg tgaagaaaaa 241 ataaggaagg tcacgtccag tgaaactgat gaaattcgag aactcttatc aagaaatctc 301 tatcaaatcc gtcagcgcac tttatcctac aacagacaca gtctgacagc agacacaagt 361 gagaggcaag ccaaggagat tctgattcgg cgtcgacaca gtttgcgaga aagcattagg 421 aaggacagca gcttgaatcg agaacacagg gcttccactt caacctcccg atatttatcc 481 ttacctaaaa atacgaagct tccagaaaag ctacaaaaga ggaggactat ttctattgca 541 gatggcaata gcagcagctc agacgcacat gccggaacca ccgtactcaa tttgc //