LOCUS       S79217                   185 bp    mRNA    linear   HUM 14-JUL-2016
DEFINITION  Homo sapiens Ca(2+)-sensing receptor mRNA, partial cds.
ACCESSION   S79217
VERSION     S79217.1
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 185)
  AUTHORS   Aida,K., Koishi,S., Inoue,M., Nakazato,M., Tawata,M. and Onaya,T.
  TITLE     Familial hypocalciuric hypercalcemia associated with mutation in
            the human Ca(2+)-sensing receptor gene
  JOURNAL   J. Clin. Endocrinol. Metab. 80 (9), 2594-2598 (1995)
   PUBMED   7673400
  REMARK    GenBank staff at the National Library of Medicine created this
            entry [NCBI gibbsq 169823] from the original journal article.
FEATURES             Location/Qualifiers
     source          1..185
                     /db_xref="H-InvDB:HIT000216832"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /cell_type="peripheral blood cells"
                     /note="Familial hypocalciuric hypercalcemia (FHH)"
     CDS             1..>185
                     /note="mutant"
                     /codon_start=1
                     /product="Ca(2+)-sensing receptor"
                     /protein_id="AAB35262.2"
                     /translation="MAFYSCCWVLLALTWHTSAYGPDQRAQKKGDIILGGLFAIHFGV
                     AAKDQDLKSRPESVECI"
BASE COUNT           44 a           45 c           50 g           46 t
ORIGIN      
        1 atggcatttt atagctgctg ctgggtcctc ttggcactca cctggcacac ctctgcctac
       61 gggccagacc agcgagccca aaagaagggg gacattatcc ttggggggct ctttgctatt
      121 cattttggag tagcagctaa agatcaagat ctcaaatcaa ggccggagtc tgtggaatgt
      181 atcag
//