LOCUS S79217 185 bp mRNA linear HUM 14-JUL-2016 DEFINITION Homo sapiens Ca(2+)-sensing receptor mRNA, partial cds. ACCESSION S79217 VERSION S79217.1 KEYWORDS . SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 185) AUTHORS Aida,K., Koishi,S., Inoue,M., Nakazato,M., Tawata,M. and Onaya,T. TITLE Familial hypocalciuric hypercalcemia associated with mutation in the human Ca(2+)-sensing receptor gene JOURNAL J. Clin. Endocrinol. Metab. 80 (9), 2594-2598 (1995) PUBMED 7673400 REMARK GenBank staff at the National Library of Medicine created this entry [NCBI gibbsq 169823] from the original journal article. FEATURES Location/Qualifiers source 1..185 /db_xref="H-InvDB:HIT000216832" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /cell_type="peripheral blood cells" /note="Familial hypocalciuric hypercalcemia (FHH)" CDS 1..>185 /note="mutant" /codon_start=1 /product="Ca(2+)-sensing receptor" /protein_id="AAB35262.2" /translation="MAFYSCCWVLLALTWHTSAYGPDQRAQKKGDIILGGLFAIHFGV AAKDQDLKSRPESVECI" BASE COUNT 44 a 45 c 50 g 46 t ORIGIN 1 atggcatttt atagctgctg ctgggtcctc ttggcactca cctggcacac ctctgcctac 61 gggccagacc agcgagccca aaagaagggg gacattatcc ttggggggct ctttgctatt 121 cattttggag tagcagctaa agatcaagat ctcaaatcaa ggccggagtc tgtggaatgt 181 atcag //