LOCUS S76824 705 bp mRNA linear HUM 26-JUL-2016 DEFINITION CD16=low affinity IgG receptor [human, glomerular mesangial cells, mRNA Partial, 705 nt]. ACCESSION S76824 VERSION S76824.1 KEYWORDS . SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 705) AUTHORS Morcos,M., Hansch,G.M., Schonermark,M., Ellwanger,S., Harle,M. and Heckl-Ostreicher,B. TITLE Human glomerular mesangial cells express CD16 and may be stimulated via this receptor JOURNAL Kidney Int. 46 (6), 1627-1634 (1994) PUBMED 7700021 REMARK GenBank staff at the National Library of Medicine created this entry [NCBI gibbsq 163666] from the original journal article. FEATURES Location/Qualifiers source 1..705 /db_xref="H-InvDB:HIT000216694" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /cell_type="glomerular mesangial cells" CDS <1..702 /note="low affinity IgG receptor; conceptual translation differs from the translation presented in the manuscript; mismatch(144[LYS->CTC]); GMC-CD16" /codon_start=1 /product="CD16" /protein_id="AAB33925.2" /translation="DLPKAVVFLEPQWYRVLEKDSVTLKCQGAYSPEDNSTQWFHNES LISSQASSYFIDAATVDDSGEYRCQTNLSTLSDPVQLEVHIGWLLLQAPRWVFKEEDP IHLRCHSWKNTALHKVTYLQNGKGRKYFHHNSDFYIPKATLKDSGSYFCRGLVGSKNV SSETVNITITQGLAVSTISSFFPPGYQVSFCLVMVLLFAVDTGLYFSVKTNIRSSTRD WKDHKFKWRKDPQDK" BASE COUNT 190 a 180 c 169 g 166 t ORIGIN 1 gatctcccaa aggctgtggt gttcctggag cctcaatggt acagggtgct cgagaaggac 61 agtgtgactc tgaagtgcca gggagcctac tcccctgagg acaattccac acagtggttt 121 cacaatgaga gcctcatctc aagccaggcc tcgagctact tcattgacgc tgccacagtc 181 gacgacagtg gagagtacag gtgccagaca aacctctcca ccctcagtga cccggtgcag 241 ctagaagtcc atatcggctg gctgttgctc caggcccctc ggtgggtgtt caaggaggaa 301 gaccctattc acctgaggtg tcacagctgg aagaacactg ctctgcataa ggtcacatat 361 ttacagaatg gcaaaggcag gaagtatttt catcataatt ctgacttcta cattccaaaa 421 gccacactca aagacagcgg ctcctacttc tgcagggggc ttgttgggag taaaaatgtg 481 tcttcagaga ctgtgaacat caccatcact caaggtttgg cagtgtcaac catctcatca 541 ttctttccac ctgggtacca agtctctttc tgcttggtga tggtactcct ttttgcagtg 601 gacacaggac tatatttctc tgtgaagaca aacattcgaa gctcaacaag agactggaag 661 gaccataaat ttaaatggag aaaggaccct caagacaaat gaccc //