LOCUS       S76824                   705 bp    mRNA    linear   HUM 26-JUL-2016
DEFINITION  CD16=low affinity IgG receptor [human, glomerular mesangial cells,
            mRNA Partial, 705 nt].
ACCESSION   S76824
VERSION     S76824.1
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 705)
  AUTHORS   Morcos,M., Hansch,G.M., Schonermark,M., Ellwanger,S., Harle,M. and
            Heckl-Ostreicher,B.
  TITLE     Human glomerular mesangial cells express CD16 and may be stimulated
            via this receptor
  JOURNAL   Kidney Int. 46 (6), 1627-1634 (1994)
   PUBMED   7700021
  REMARK    GenBank staff at the National Library of Medicine created this
            entry [NCBI gibbsq 163666] from the original journal article.
FEATURES             Location/Qualifiers
     source          1..705
                     /db_xref="H-InvDB:HIT000216694"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /cell_type="glomerular mesangial cells"
     CDS             <1..702
                     /note="low affinity IgG receptor; conceptual translation
                     differs from the translation presented in the manuscript;
                     mismatch(144[LYS->CTC]); GMC-CD16"
                     /codon_start=1
                     /product="CD16"
                     /protein_id="AAB33925.2"
                     /translation="DLPKAVVFLEPQWYRVLEKDSVTLKCQGAYSPEDNSTQWFHNES
                     LISSQASSYFIDAATVDDSGEYRCQTNLSTLSDPVQLEVHIGWLLLQAPRWVFKEEDP
                     IHLRCHSWKNTALHKVTYLQNGKGRKYFHHNSDFYIPKATLKDSGSYFCRGLVGSKNV
                     SSETVNITITQGLAVSTISSFFPPGYQVSFCLVMVLLFAVDTGLYFSVKTNIRSSTRD
                     WKDHKFKWRKDPQDK"
BASE COUNT          190 a          180 c          169 g          166 t
ORIGIN      
        1 gatctcccaa aggctgtggt gttcctggag cctcaatggt acagggtgct cgagaaggac
       61 agtgtgactc tgaagtgcca gggagcctac tcccctgagg acaattccac acagtggttt
      121 cacaatgaga gcctcatctc aagccaggcc tcgagctact tcattgacgc tgccacagtc
      181 gacgacagtg gagagtacag gtgccagaca aacctctcca ccctcagtga cccggtgcag
      241 ctagaagtcc atatcggctg gctgttgctc caggcccctc ggtgggtgtt caaggaggaa
      301 gaccctattc acctgaggtg tcacagctgg aagaacactg ctctgcataa ggtcacatat
      361 ttacagaatg gcaaaggcag gaagtatttt catcataatt ctgacttcta cattccaaaa
      421 gccacactca aagacagcgg ctcctacttc tgcagggggc ttgttgggag taaaaatgtg
      481 tcttcagaga ctgtgaacat caccatcact caaggtttgg cagtgtcaac catctcatca
      541 ttctttccac ctgggtacca agtctctttc tgcttggtga tggtactcct ttttgcagtg
      601 gacacaggac tatatttctc tgtgaagaca aacattcgaa gctcaacaag agactggaag
      661 gaccataaat ttaaatggag aaaggaccct caagacaaat gaccc
//