LOCUS       S69687                   192 bp    mRNA    linear   HUM 26-JUL-2016
DEFINITION  SP-A1=SP-A1 gamma {5' region, alternatively spliced} [human, fetal
            lung explants, mRNA Partial, 192 nt].
ACCESSION   S69687
VERSION     S69687.1
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 192)
  AUTHORS   McCormick,S.M., Boggaram,V. and Mendelson,C.R.
  TITLE     Characterization of mRNA transcripts and organization of human
            SP-A1 and SP-A2 genes
  JOURNAL   Am. J. Physiol. 266 (4 PT 1), L354-L366 (1994)
   PUBMED   8179012
  REMARK    GenBank staff at the National Library of Medicine created this
            entry [NCBI gibbsq 146438] from the original journal article.
FEATURES             Location/Qualifiers
     source          1..192
                     /db_xref="H-InvDB:HIT000216341_03"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
     gene            1..192
                     /gene="SP-A1"
                     /note="SP-A1 gamma"
     CDS             78..191
                     /gene="SP-A1"
                     /note="surfactant protein"
                     /codon_start=1
                     /product="SP-A1 gamma"
                     /protein_id="AAB30736.1"
                     /translation="MRPCQVPGAATGPRAMWLCPLALNLILMAASGAACEVK"
BASE COUNT           38 a           58 c           65 g           31 t
ORIGIN      
        1 ggaggcagag acccaagcag ctggaggctc tgtgtgtggc ctggagaccc cacaacctcc
       61 agccggaggc ctgaagcatg aggccatgcc aggtgccagg agcagcgact ggacccagag
      121 ccatgtggct gtgccctctg gccctcaacc tcatcttgat ggcagcctct ggtgctgcgt
      181 gcgaagtgaa gg
//