LOCUS S69683 210 bp mRNA linear HUM 26-JUL-2016 DEFINITION SP-A2=SP-A2 delta {5' region, alternatively spliced} [human, fetal lung explants, mRNA Partial, 210 nt]. ACCESSION S69683 VERSION S69683.1 KEYWORDS . SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 210) AUTHORS McCormick,S.M., Boggaram,V. and Mendelson,C.R. TITLE Characterization of mRNA transcripts and organization of human SP-A1 and SP-A2 genes JOURNAL Am. J. Physiol. 266 (4 PT 1), L354-L366 (1994) PUBMED 8179012 REMARK GenBank staff at the National Library of Medicine created this entry [NCBI gibbsq 146431] from the original journal article. FEATURES Location/Qualifiers source 1..210 /db_xref="H-InvDB:HIT000216338_03" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" gene 1..210 /gene="SP-A2" /note="SP-A2 delta" CDS 87..209 /gene="SP-A2" /note="surfactant protein" /codon_start=1 /product="SP-A2 delta" /protein_id="AAB30733.1" /translation="MRDRWSESVTGAATGPRAMWLCPLALNLILMAASGAACEVK" BASE COUNT 47 a 47 c 73 g 43 t ORIGIN 1 aacttggagg cagagaccca agcagctgga ggctctgtgt gtgggtcgct gatttcttgg 61 agcctgaaaa gaaggtaact gggcatatga gggacagatg gagtgagtca gtgacaggag 121 cagcgactgg acccagagcc atgtggctgt gccctctggc cctcaacctc atcttgatgg 181 cagcctctgg tgctgcgtgc gaagtgaagg //