LOCUS       S69683                   210 bp    mRNA    linear   HUM 26-JUL-2016
DEFINITION  SP-A2=SP-A2 delta {5' region, alternatively spliced} [human, fetal
            lung explants, mRNA Partial, 210 nt].
ACCESSION   S69683
VERSION     S69683.1
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 210)
  AUTHORS   McCormick,S.M., Boggaram,V. and Mendelson,C.R.
  TITLE     Characterization of mRNA transcripts and organization of human
            SP-A1 and SP-A2 genes
  JOURNAL   Am. J. Physiol. 266 (4 PT 1), L354-L366 (1994)
   PUBMED   8179012
  REMARK    GenBank staff at the National Library of Medicine created this
            entry [NCBI gibbsq 146431] from the original journal article.
FEATURES             Location/Qualifiers
     source          1..210
                     /db_xref="H-InvDB:HIT000216338_03"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
     gene            1..210
                     /gene="SP-A2"
                     /note="SP-A2 delta"
     CDS             87..209
                     /gene="SP-A2"
                     /note="surfactant protein"
                     /codon_start=1
                     /product="SP-A2 delta"
                     /protein_id="AAB30733.1"
                     /translation="MRDRWSESVTGAATGPRAMWLCPLALNLILMAASGAACEVK"
BASE COUNT           47 a           47 c           73 g           43 t
ORIGIN      
        1 aacttggagg cagagaccca agcagctgga ggctctgtgt gtgggtcgct gatttcttgg
       61 agcctgaaaa gaaggtaact gggcatatga gggacagatg gagtgagtca gtgacaggag
      121 cagcgactgg acccagagcc atgtggctgt gccctctggc cctcaacctc atcttgatgg
      181 cagcctctgg tgctgcgtgc gaagtgaagg
//