LOCUS S66705 385 bp mRNA linear HUM 26-JUL-2016 DEFINITION P0=28 kda major peripheral myelin protein [human, Charcot-Marie-Tooth disease type 1B patient, mRNA PartialMutant, 385 nt]. ACCESSION S66705 VERSION S66705.1 KEYWORDS . SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 385) AUTHORS Kulkens,T., Bolhuis,P.A., Wolterman,R.A., Kemp,S., te Nijenhuis,S., Valentijn,L.J., Hensels,G.W., Jennekens,F.G., de Visser,M., Hoogendijk,J.E. et al. TITLE Deletion of the serine 34 codon from the major peripheral myelin protein P0 gene in Charcot-Marie-Tooth disease type 1B JOURNAL Nat. Genet. 5 (1), 35-39 (1993) PUBMED 7693130 REMARK GenBank staff at the National Library of Medicine created this entry [NCBI gibbsq 139302] from the original journal article. COMMENT deletion of Ser34. FEATURES Location/Qualifiers source 1..385 /db_xref="H-InvDB:HIT000216135" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" gene 1..385 /gene="P0" CDS 42..383 /gene="P0" /note="28 kda major peripheral myelin protein" /codon_start=1 /product="P0" /protein_id="AAB28708.1" /translation="MAPGAPSSSPSPILAVLLFSSLVLSPAQAIVVYTDREVHGAVGS RVTLHCSFWSSEWVSDDIFTWRYQPEGGRDAISIFHYAKGQPYIDEVGTFKERIQWVG DPRWKDGSIVIH" BASE COUNT 67 a 129 c 105 g 84 t ORIGIN 1 caaccccaca gatgctccgg gcccctgccc ctgccccagc tatggctcct ggggctccct 61 catccagccc cagccctatc ctggctgtgc tgctcttctc ttctttggtg ctgtccccgg 121 cccaggccat cgtggtttac accgacaggg aggtccatgg tgctgtgggc tcccgggtga 181 ccctgcactg ctccttctgg tccagtgagt gggtctcaga tgacatcttc acctggcgct 241 accagcccga aggaggcaga gatgccattt cgatcttcca ctatgccaag ggacaaccct 301 acattgacga ggtggggacc ttcaaagagc gcatccagtg ggtaggggac cctcgctgga 361 aggatggctc cattgtcata cacaa //