LOCUS S60797 350 bp mRNA linear HUM 26-JUL-2016 DEFINITION Homo sapiens T-cell receptor beta chain variable region (TCRbeta; V 22.3) mRNA, partial cds. ACCESSION S60797 VERSION S60797.1 KEYWORDS . SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 350) AUTHORS Tsuruta,Y., Iwagami,S., Furue,S., Teraoka,H., Yoshida,T., Sakata,T. and Suzuki,R. TITLE Detection of human T cell receptor cDNAs (alpha, beta, gamma and delta) by ligation of a universal adaptor to variable region JOURNAL J. Immunol. Methods 161 (1), 7-21 (1993) PUBMED 8486930 REMARK GenBank staff at the National Library of Medicine created this entry [NCBI gibbsq 132330] from the original journal article. FEATURES Location/Qualifiers source 1..350 /db_xref="H-InvDB:HIT000215949" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /cell_type="mononuclear cellls" gene 1..>350 /gene="TCRbeta; V 22.3" CDS 16..>350 /gene="TCRbeta; V 22.3" /codon_start=1 /product="T-cell receptor beta chain variable region" /protein_id="AAC60598.1" /translation="MSTRLLCWMALCLLGAELSEAEVAQSPRYKITEKSQAVAFWCDP ISGHATLYWYRQILGQGPELLVQFQDESVVDDSQLPKDRFSAERLKGVDSTLKIQPAE LGDSAMYLCA" BASE COUNT 75 a 91 c 95 g 89 t ORIGIN 1 tgccctgacc ctgccatgag caccaggctt ctctgctgga tggccctctg tctcctgggg 61 gcagaactct cagaagctga agttgcccag tcccccagat ataagattac agagaaaagc 121 caggctgtgg ctttttggtg tgatcctatt tctggccatg ctacccttta ctggtaccgg 181 cagatcctgg gacagggccc ggagcttctg gttcaatttc aggatgagag tgtagtagat 241 gattcacagt tgcctaagga tcgattttct gcagagaggc tcaaaggagt agactccact 301 ctcaagatcc agcctgcaga gcttggggac tcggccatgt atctctgtgc //