LOCUS       S60797                   350 bp    mRNA    linear   HUM 26-JUL-2016
DEFINITION  Homo sapiens T-cell receptor beta chain variable region (TCRbeta; V
            22.3) mRNA, partial cds.
ACCESSION   S60797
VERSION     S60797.1
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 350)
  AUTHORS   Tsuruta,Y., Iwagami,S., Furue,S., Teraoka,H., Yoshida,T., Sakata,T.
            and Suzuki,R.
  TITLE     Detection of human T cell receptor cDNAs (alpha, beta, gamma and
            delta) by ligation of a universal adaptor to variable region
  JOURNAL   J. Immunol. Methods 161 (1), 7-21 (1993)
   PUBMED   8486930
  REMARK    GenBank staff at the National Library of Medicine created this
            entry [NCBI gibbsq 132330] from the original journal article.
FEATURES             Location/Qualifiers
     source          1..350
                     /db_xref="H-InvDB:HIT000215949"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /cell_type="mononuclear cellls"
     gene            1..>350
                     /gene="TCRbeta; V 22.3"
     CDS             16..>350
                     /gene="TCRbeta; V 22.3"
                     /codon_start=1
                     /product="T-cell receptor beta chain variable region"
                     /protein_id="AAC60598.1"
                     /translation="MSTRLLCWMALCLLGAELSEAEVAQSPRYKITEKSQAVAFWCDP
                     ISGHATLYWYRQILGQGPELLVQFQDESVVDDSQLPKDRFSAERLKGVDSTLKIQPAE
                     LGDSAMYLCA"
BASE COUNT           75 a           91 c           95 g           89 t
ORIGIN      
        1 tgccctgacc ctgccatgag caccaggctt ctctgctgga tggccctctg tctcctgggg
       61 gcagaactct cagaagctga agttgcccag tcccccagat ataagattac agagaaaagc
      121 caggctgtgg ctttttggtg tgatcctatt tctggccatg ctacccttta ctggtaccgg
      181 cagatcctgg gacagggccc ggagcttctg gttcaatttc aggatgagag tgtagtagat
      241 gattcacagt tgcctaagga tcgattttct gcagagaggc tcaaaggagt agactccact
      301 ctcaagatcc agcctgcaga gcttggggac tcggccatgt atctctgtgc
//