LOCUS       S59012                   753 bp    mRNA    linear   HUM 23-JUL-1993
DEFINITION  carbohydrate binding protein 35=epithelial-specific lectin [human,
            normal colonic mucosa, colon carcinoma, cell line clone A, mRNA
            Partial, 753 nt].
ACCESSION   S59012
VERSION     S59012.1
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 753)
  AUTHORS   Lotz,M.M., Andrews,C.W. Jr., Korzelius,C.A., Lee,E.C., Steele,G.D.
            Jr., Clarke,A. and Mercurio,A.M.
  TITLE     Decreased expression of Mac-2 (carbohydrate binding protein 35) and
            loss of its nuclear localization are associated with the neoplastic
            progression of colon carcinoma
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 90 (8), 3466-3470 (1993)
   PUBMED   7682704
  REMARK    GenBank staff at the National Library of Medicine created this
            entry [NCBI gibbsq 129689] from the original journal article.
FEATURES             Location/Qualifiers
     source          1..753
                     /db_xref="H-InvDB:HIT000215879"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
     gene            1..753
                     /gene="carbohydrate binding protein 35, Mac-2, CBP 35"
     CDS             1..753
                     /gene="carbohydrate binding protein 35, Mac-2, CBP 35"
                     /note="epithelial-specific lectin; Mac-2; CBP 35"
                     /codon_start=1
                     /product="carbohydrate binding protein 35"
                     /protein_id="AAB26229.1"
                     /translation="MADNFSLHDALSGSGNPNPQGWPGAWGNQPAGAGGYPGASYPGA
                     YPGQAPPGAYPGQAPPGAYPGAPGAYPGAPAPGVYPGPPSGPGAYPSSGQPSATGAYP
                     ATGPYGAPAGPLIVPYNLPLPGGVVPRMLITILGTVKPNANRIALDFQRGNDVAFHFN
                     PRFNENNRRVIVCNTKLDNNWGREERQSVFPFESGKPFKIQVLVEPDHFKVAVNDAHL
                     LQYNHRVKKLNEISKLGISGDIDLTSASYTMI"
BASE COUNT          188 a          207 c          194 g          164 t
ORIGIN      
        1 atggcagaca atttttcgct ccatgatgcg ttatctgggt ctggaaaccc aaaccctcaa
       61 ggatggcctg gcgcatgggg gaaccagcct gctggggcag ggggctaccc aggggcttcc
      121 tatcctgggg cctaccccgg gcaggcaccc ccaggggctt atcctggaca ggcacctcca
      181 ggcgcctacc ctggagcacc tggagcttat cccggagcac ctgcacctgg agtctaccca
      241 gggccaccca gcggccctgg ggcctaccca tcttctggac agccaagtgc caccggagcc
      301 taccctgcca ctggccccta tggcgcccct gctgggccac tgattgtgcc ttataacctg
      361 cctttgcctg ggggagtggt gcctcgcatg ctgataacaa ttctgggcac ggtgaagccc
      421 aatgcaaaca gaattgcttt agatttccaa agagggaatg atgttgcctt ccactttaac
      481 ccacgcttca atgagaacaa caggagagtc attgtttgca atacaaagct ggataataac
      541 tggggaaggg aagaaagaca gtcggttttc ccatttgaaa gtgggaaacc attcaaaata
      601 caagtactgg ttgaacctga ccacttcaag gttgcagtga atgatgctca cttgttgcag
      661 tacaatcatc gggttaaaaa actcaatgaa atcagcaaac tgggaatttc tggtgacata
      721 gacctcacca gtgcttcata taccatgata taa
//