LOCUS S59012 753 bp mRNA linear HUM 23-JUL-1993 DEFINITION carbohydrate binding protein 35=epithelial-specific lectin [human, normal colonic mucosa, colon carcinoma, cell line clone A, mRNA Partial, 753 nt]. ACCESSION S59012 VERSION S59012.1 KEYWORDS . SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 753) AUTHORS Lotz,M.M., Andrews,C.W. Jr., Korzelius,C.A., Lee,E.C., Steele,G.D. Jr., Clarke,A. and Mercurio,A.M. TITLE Decreased expression of Mac-2 (carbohydrate binding protein 35) and loss of its nuclear localization are associated with the neoplastic progression of colon carcinoma JOURNAL Proc. Natl. Acad. Sci. U.S.A. 90 (8), 3466-3470 (1993) PUBMED 7682704 REMARK GenBank staff at the National Library of Medicine created this entry [NCBI gibbsq 129689] from the original journal article. FEATURES Location/Qualifiers source 1..753 /db_xref="H-InvDB:HIT000215879" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" gene 1..753 /gene="carbohydrate binding protein 35, Mac-2, CBP 35" CDS 1..753 /gene="carbohydrate binding protein 35, Mac-2, CBP 35" /note="epithelial-specific lectin; Mac-2; CBP 35" /codon_start=1 /product="carbohydrate binding protein 35" /protein_id="AAB26229.1" /translation="MADNFSLHDALSGSGNPNPQGWPGAWGNQPAGAGGYPGASYPGA YPGQAPPGAYPGQAPPGAYPGAPGAYPGAPAPGVYPGPPSGPGAYPSSGQPSATGAYP ATGPYGAPAGPLIVPYNLPLPGGVVPRMLITILGTVKPNANRIALDFQRGNDVAFHFN PRFNENNRRVIVCNTKLDNNWGREERQSVFPFESGKPFKIQVLVEPDHFKVAVNDAHL LQYNHRVKKLNEISKLGISGDIDLTSASYTMI" BASE COUNT 188 a 207 c 194 g 164 t ORIGIN 1 atggcagaca atttttcgct ccatgatgcg ttatctgggt ctggaaaccc aaaccctcaa 61 ggatggcctg gcgcatgggg gaaccagcct gctggggcag ggggctaccc aggggcttcc 121 tatcctgggg cctaccccgg gcaggcaccc ccaggggctt atcctggaca ggcacctcca 181 ggcgcctacc ctggagcacc tggagcttat cccggagcac ctgcacctgg agtctaccca 241 gggccaccca gcggccctgg ggcctaccca tcttctggac agccaagtgc caccggagcc 301 taccctgcca ctggccccta tggcgcccct gctgggccac tgattgtgcc ttataacctg 361 cctttgcctg ggggagtggt gcctcgcatg ctgataacaa ttctgggcac ggtgaagccc 421 aatgcaaaca gaattgcttt agatttccaa agagggaatg atgttgcctt ccactttaac 481 ccacgcttca atgagaacaa caggagagtc attgtttgca atacaaagct ggataataac 541 tggggaaggg aagaaagaca gtcggttttc ccatttgaaa gtgggaaacc attcaaaata 601 caagtactgg ttgaacctga ccacttcaag gttgcagtga atgatgctca cttgttgcag 661 tacaatcatc gggttaaaaa actcaatgaa atcagcaaac tgggaatttc tggtgacata 721 gacctcacca gtgcttcata taccatgata taa //