LOCUS       S50732                   440 bp    mRNA    linear   HUM 05-NOV-2018
DEFINITION  Homo sapiens immunoglobulin M light chain V region mRNA, partial
            cds.
ACCESSION   S50732
VERSION     S50732.2
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 440)
  AUTHORS   Dorai,H., Bubbers,J.E. and Gillies,S.D.
  TITLE     Cloning and reexpression of a functional human IgM anti-lipid A
            antibody
  JOURNAL   Hybridoma 11 (5), 667-675 (1992)
   PUBMED   1459589
  REMARK    GenBank staff at the National Library of Medicine created this
            entry [NCBI gibbsq 120606] from the original journal article.
REFERENCE   2  (bases 1 to 440)
  AUTHORS   Weaver,L.M. and Amasino,R.M.
  TITLE     Direct Submission
  JOURNAL   Submitted (05-NOV-2018) Department of Biochemistry, University of
            Wisconsin at Madison, 420 Henry Mall, Madison, WI 53706, USA
  REMARK    GenBank staff at the National Library of Medicine created this
            entry [NCBI gibbsq 120606] from the original journal article.
            Sequence update by database staff to remove vector contamination
COMMENT     On Nov 5, 2018 this sequence version replaced S50732.1.
FEATURES             Location/Qualifiers
     source          1..440
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /cell_line="hybridoma cell line HR78"
     CDS             18..>440
                     /note="anti-lipid A antibody"
                     /codon_start=1
                     /product="immunoglobulin M light chain V region"
                     /protein_id="AAB24404.1"
                     /translation="MVLQTQVFISLLLWISGAYGDIVMTQSPDSLAVSLGERATINCK
                     SSQSLLYSSNNKNYLAWYQQKPGQPPKLLIYWASTRESGVPDRFSGSGSGTDFTLTIS
                     SLQAEDVAVYYCQQYYSTPPMFGQGTKVEIKRTVAAPSV"
BASE COUNT          102 a          120 c          114 g          104 t
ORIGIN      
        1 caggcagggg cagcaagatg gtgttgcaga cccaggtctt catttctctg ttgctctgga
       61 tctctggtgc ctacggggac atcgtgatga cccagtctcc agactccctg gctgtgtctc
      121 tgggcgagag ggccaccatc aactgcaagt ccagccagag tcttttatac agctccaaca
      181 ataagaacta cttagcttgg taccagcaga aaccaggaca gcctcctaag ttgctcattt
      241 actgggcatc tacccgggaa tccggggtcc ctgaccgatt cagtggcagc gggtctggga
      301 cagatttcac tctcaccatc agcagcctgc aggctgaaga tgtggcagtt tattactgtc
      361 agcaatatta tagtactcct ccgatgttcg gccaagggac caaggtggaa atcaaacgaa
      421 ctgtggctgc accatctgtc
//