LOCUS S50732 440 bp mRNA linear HUM 05-NOV-2018 DEFINITION Homo sapiens immunoglobulin M light chain V region mRNA, partial cds. ACCESSION S50732 VERSION S50732.2 KEYWORDS . SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 440) AUTHORS Dorai,H., Bubbers,J.E. and Gillies,S.D. TITLE Cloning and reexpression of a functional human IgM anti-lipid A antibody JOURNAL Hybridoma 11 (5), 667-675 (1992) PUBMED 1459589 REMARK GenBank staff at the National Library of Medicine created this entry [NCBI gibbsq 120606] from the original journal article. REFERENCE 2 (bases 1 to 440) AUTHORS Weaver,L.M. and Amasino,R.M. TITLE Direct Submission JOURNAL Submitted (05-NOV-2018) Department of Biochemistry, University of Wisconsin at Madison, 420 Henry Mall, Madison, WI 53706, USA REMARK GenBank staff at the National Library of Medicine created this entry [NCBI gibbsq 120606] from the original journal article. Sequence update by database staff to remove vector contamination COMMENT On Nov 5, 2018 this sequence version replaced S50732.1. FEATURES Location/Qualifiers source 1..440 /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /cell_line="hybridoma cell line HR78" CDS 18..>440 /note="anti-lipid A antibody" /codon_start=1 /product="immunoglobulin M light chain V region" /protein_id="AAB24404.1" /translation="MVLQTQVFISLLLWISGAYGDIVMTQSPDSLAVSLGERATINCK SSQSLLYSSNNKNYLAWYQQKPGQPPKLLIYWASTRESGVPDRFSGSGSGTDFTLTIS SLQAEDVAVYYCQQYYSTPPMFGQGTKVEIKRTVAAPSV" BASE COUNT 102 a 120 c 114 g 104 t ORIGIN 1 caggcagggg cagcaagatg gtgttgcaga cccaggtctt catttctctg ttgctctgga 61 tctctggtgc ctacggggac atcgtgatga cccagtctcc agactccctg gctgtgtctc 121 tgggcgagag ggccaccatc aactgcaagt ccagccagag tcttttatac agctccaaca 181 ataagaacta cttagcttgg taccagcaga aaccaggaca gcctcctaag ttgctcattt 241 actgggcatc tacccgggaa tccggggtcc ctgaccgatt cagtggcagc gggtctggga 301 cagatttcac tctcaccatc agcagcctgc aggctgaaga tgtggcagtt tattactgtc 361 agcaatatta tagtactcct ccgatgttcg gccaagggac caaggtggaa atcaaacgaa 421 ctgtggctgc accatctgtc //