LOCUS       S44881                   143 bp    mRNA    linear   HUM 26-JUL-2016
DEFINITION  HL14=beta-galactoside binding protein [human, line CEM C7, mRNA
            Partial, 143 nt].
ACCESSION   S44881
VERSION     S44881.1
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 143)
  AUTHORS   Goldstone,S.D. and Lavin,M.F.
  TITLE     Isolation of a cDNA clone, encoding a human beta-galactoside
            binding protein, overexpressed during glucocorticoid-induced cell
            death
  JOURNAL   Biochem. Biophys. Res. Commun. 178 (2), 746-750 (1991)
   PUBMED   1713454
  REMARK    GenBank staff at the National Library of Medicine created this
            entry [NCBI gibbsq 44881] from the original journal article.
COMMENT     On Nov 21, 1996 this sequence version replaced gi:1619723.
FEATURES             Location/Qualifiers
     source          1..143
                     /db_xref="H-InvDB:HIT000215618"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /cell_line="CEM C7"
     gene            <1..143
                     /gene="HL14"
                     /note="beta-galactoside binding protein"
     CDS             <1..93
                     /gene="HL14"
                     /note="beta-galactoside binding protein; conceptual
                     translation presented here differs from translation in
                     publication"
                     /codon_start=1
                     /protein_id="AAB19412.2"
                     /translation="EFKFPNRLNLEAINYIAADGDFKIKCVAFD"
BASE COUNT           36 a           48 c           30 g           29 t
ORIGIN      
        1 gaattcaagt tccccaaccg cctcaacctg gaggccatca actacatcgc agctgacggt
       61 gacttcaaga tcaaatgtgt ggcctttgac tgaaatcagc cagcccatgg cccccaataa
      121 aggcagctgc ctctgctccc ctg
//