LOCUS S44881 143 bp mRNA linear HUM 26-JUL-2016 DEFINITION HL14=beta-galactoside binding protein [human, line CEM C7, mRNA Partial, 143 nt]. ACCESSION S44881 VERSION S44881.1 KEYWORDS . SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 143) AUTHORS Goldstone,S.D. and Lavin,M.F. TITLE Isolation of a cDNA clone, encoding a human beta-galactoside binding protein, overexpressed during glucocorticoid-induced cell death JOURNAL Biochem. Biophys. Res. Commun. 178 (2), 746-750 (1991) PUBMED 1713454 REMARK GenBank staff at the National Library of Medicine created this entry [NCBI gibbsq 44881] from the original journal article. COMMENT On Nov 21, 1996 this sequence version replaced gi:1619723. FEATURES Location/Qualifiers source 1..143 /db_xref="H-InvDB:HIT000215618" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /cell_line="CEM C7" gene <1..143 /gene="HL14" /note="beta-galactoside binding protein" CDS <1..93 /gene="HL14" /note="beta-galactoside binding protein; conceptual translation presented here differs from translation in publication" /codon_start=1 /protein_id="AAB19412.2" /translation="EFKFPNRLNLEAINYIAADGDFKIKCVAFD" BASE COUNT 36 a 48 c 30 g 29 t ORIGIN 1 gaattcaagt tccccaaccg cctcaacctg gaggccatca actacatcgc agctgacggt 61 gacttcaaga tcaaatgtgt ggcctttgac tgaaatcagc cagcccatgg cccccaataa 121 aggcagctgc ctctgctccc ctg //