LOCUS       HUMAGGCRB                480 bp    mRNA    linear   HUM 11-AUG-1993
DEFINITION  Human epidermal growth factor receptor-related gene, 5' end.
ACCESSION   M99624
VERSION     M99624.1
KEYWORDS    epidermal growth factor receptor-related protein.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 480)
  AUTHORS   Kielman,M.F., Smits,R., Devi,T.S., Fodde,R. and Bernini,L.F.
  TITLE     Homology of a 130-kb region enclosing the alpha-globin gene
            cluster, the alpha-locus controlling region, and two non-globin
            genes in human and mouse
  JOURNAL   Mamm. Genome 4 (6), 314-323 (1993)
   PUBMED   8318735
COMMENT     Original source text: Homo sapiens male adult brain cDNA to mRNA.
FEATURES             Location/Qualifiers
     source          1..480
                     /db_xref="H-InvDB:HIT000197063"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /map="16p13-16pter"
                     /sex="male"
                     /tissue_type="brain"
                     /dev_stage="adult"
                     /germline
     CDS             241..>480
                     /codon_start=1
                     /product="epidermal growth factor receptor-related
                     protein"
                     /protein_id="AAA02490.1"
                     /translation="MDCVITGRPCCIGTKGRCEITSREYCDFMRGYFHEEATLCSQVH
                     CMDDVCGLLPFLNPEVPDQFYRLWLSLFLHAGILHC"
BASE COUNT           94 a          152 c          137 g           97 t
ORIGIN      
        1 tgcgtgcaga cctcggagga ggagtgctcg tccacgctgg cagtgtgggt gaagtggccc
       61 atccatccca gcgccccaga gcttgcgggc cacaagagac agtttggctc tgtctgccac
      121 cagggatccc aggtgtgtga tgagccctcc tccgaagacc ctcatgagtg gccagaagac
      181 atcaccaagt ggccgatctg caccaaaaac agcgctggga accacaccaa ccatccccac
      241 atggactgtg tcatcacagg acggccctgc tgcattggca ccaagggcag gtgtgagatc
      301 acctcccggg agtactgtga cttcatgagg ggctacttcc atgaggaggc cacgctctgc
      361 tctcaggtgc actgcatgga tgatgtgtgt gggctcctgc cttttctcaa ccccgaggtg
      421 cctgaccagt tctaccgcct gtggctatcc ctcttcctgc acgccgggat cttgcactgc
//