LOCUS HUMAGGCRB 480 bp mRNA linear HUM 11-AUG-1993 DEFINITION Human epidermal growth factor receptor-related gene, 5' end. ACCESSION M99624 VERSION M99624.1 KEYWORDS epidermal growth factor receptor-related protein. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 480) AUTHORS Kielman,M.F., Smits,R., Devi,T.S., Fodde,R. and Bernini,L.F. TITLE Homology of a 130-kb region enclosing the alpha-globin gene cluster, the alpha-locus controlling region, and two non-globin genes in human and mouse JOURNAL Mamm. Genome 4 (6), 314-323 (1993) PUBMED 8318735 COMMENT Original source text: Homo sapiens male adult brain cDNA to mRNA. FEATURES Location/Qualifiers source 1..480 /db_xref="H-InvDB:HIT000197063" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /map="16p13-16pter" /sex="male" /tissue_type="brain" /dev_stage="adult" /germline CDS 241..>480 /codon_start=1 /product="epidermal growth factor receptor-related protein" /protein_id="AAA02490.1" /translation="MDCVITGRPCCIGTKGRCEITSREYCDFMRGYFHEEATLCSQVH CMDDVCGLLPFLNPEVPDQFYRLWLSLFLHAGILHC" BASE COUNT 94 a 152 c 137 g 97 t ORIGIN 1 tgcgtgcaga cctcggagga ggagtgctcg tccacgctgg cagtgtgggt gaagtggccc 61 atccatccca gcgccccaga gcttgcgggc cacaagagac agtttggctc tgtctgccac 121 cagggatccc aggtgtgtga tgagccctcc tccgaagacc ctcatgagtg gccagaagac 181 atcaccaagt ggccgatctg caccaaaaac agcgctggga accacaccaa ccatccccac 241 atggactgtg tcatcacagg acggccctgc tgcattggca ccaagggcag gtgtgagatc 301 acctcccggg agtactgtga cttcatgagg ggctacttcc atgaggaggc cacgctctgc 361 tctcaggtgc actgcatgga tgatgtgtgt gggctcctgc cttttctcaa ccccgaggtg 421 cctgaccagt tctaccgcct gtggctatcc ctcttcctgc acgccgggat cttgcactgc //