LOCUS       HUMCD59LY                578 bp    mRNA    linear   HUM 17-JAN-1995
DEFINITION  Homo sapiens Ly-6-like protein (CD59) mRNA, complete cds.
ACCESSION   M95708
VERSION     M95708.1
KEYWORDS    Ly-6-like protein.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 578)
  AUTHORS   Davies,A., Simmons,D.L., Hale,G., Harrison,R.A., Tighe,H.,
            Lachmann,P.J. and Waldmann,H.
  TITLE     CD59, an LY-6-like protein expressed in human lymphoid cells,
            regulates the action of the complement membrane attack complex on
            homologous cells
  JOURNAL   J. Exp. Med. 170 (3), 637-654 (1989)
   PUBMED   2475570
REFERENCE   2  (bases 1 to 578)
  AUTHORS   Wang,X., Liebhaber,S.A. and Cooke,N.E.
  JOURNAL   Unpublished
COMMENT     Original source text: Homo sapiens cDNA to mRNA.
FEATURES             Location/Qualifiers
     source          1..578
                     /db_xref="H-InvDB:HIT000196903"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /map="11p14-p13"
                     /cell_type="lymphoid"
     gene            1..578
                     /gene="CD59"
     mRNA            1..578
                     /gene="CD59"
                     /note="G00-119-769"
     5'UTR           1..62
                     /gene="CD59"
                     /note="G00-119-769"
     CDS             63..449
                     /gene="CD59"
                     /function="regulates the action of the complex on
                     homologous cells"
                     /codon_start=1
                     /product="Ly-6-like protein"
                     /protein_id="AAA60957.1"
                     /db_xref="GDB:G00-119-769"
                     /translation="MGIQGGSVLFGLLLVLAVFCHSGHSLQCYNCPNPTADCKTAVNC
                     SSDFDACLITKAGLQVYNKCWKFEHCNFNDVTTRLRENELTYYCCKKDLCNFNEQLEN
                     GGTSLSEKTVLLLVTPFLAAAWSLHP"
     sig_peptide     63..134
                     /gene="CD59"
                     /note="G00-119-769"
     3'UTR           471..577
                     /gene="CD59"
                     /note="G00-119-769"
     polyA_site      560..565
                     /gene="CD59"
BASE COUNT          147 a          140 c          131 g          160 t
ORIGIN      
        1 ctttagcacc agttggtgta ggagttgaga cctacttcac agtagttctg tggacaatca
       61 caatgggaat ccaaggaggg tctgtcctgt tcgggctgct gctcgtcctg gctgtcttct
      121 gccattcagg tcatagcctg cagtgctaca actgtcctaa cccaactgct gactgcaaaa
      181 cagccgtcaa ttgttcatct gattttgatg cgtgtctcat taccaaagct gggttacaag
      241 tgtataacaa gtgttggaag tttgagcatt gcaatttcaa cgacgtcaca acccgcttga
      301 gggaaaatga gctaacgtac tactgctgca agaaggacct gtgtaacttt aacgaacagc
      361 ttgaaaatgg tgggacatcc ttatcagaga aaacagttct tctgctggtg actccatttc
      421 tggcagcagc ctggagcctt catccctaag tcaacaccag gagagcttct cccaaactcc
      481 ccgttcctgc gtagtccgct ttctcttgct gccacattct aaaggcttga tattttccaa
      541 atggatcctg ttgggaaaga ataaaattag cttgagca
//