LOCUS HUMCD59LY 578 bp mRNA linear HUM 17-JAN-1995 DEFINITION Homo sapiens Ly-6-like protein (CD59) mRNA, complete cds. ACCESSION M95708 VERSION M95708.1 KEYWORDS Ly-6-like protein. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 578) AUTHORS Davies,A., Simmons,D.L., Hale,G., Harrison,R.A., Tighe,H., Lachmann,P.J. and Waldmann,H. TITLE CD59, an LY-6-like protein expressed in human lymphoid cells, regulates the action of the complement membrane attack complex on homologous cells JOURNAL J. Exp. Med. 170 (3), 637-654 (1989) PUBMED 2475570 REFERENCE 2 (bases 1 to 578) AUTHORS Wang,X., Liebhaber,S.A. and Cooke,N.E. JOURNAL Unpublished COMMENT Original source text: Homo sapiens cDNA to mRNA. FEATURES Location/Qualifiers source 1..578 /db_xref="H-InvDB:HIT000196903" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /map="11p14-p13" /cell_type="lymphoid" gene 1..578 /gene="CD59" mRNA 1..578 /gene="CD59" /note="G00-119-769" 5'UTR 1..62 /gene="CD59" /note="G00-119-769" CDS 63..449 /gene="CD59" /function="regulates the action of the complex on homologous cells" /codon_start=1 /product="Ly-6-like protein" /protein_id="AAA60957.1" /db_xref="GDB:G00-119-769" /translation="MGIQGGSVLFGLLLVLAVFCHSGHSLQCYNCPNPTADCKTAVNC SSDFDACLITKAGLQVYNKCWKFEHCNFNDVTTRLRENELTYYCCKKDLCNFNEQLEN GGTSLSEKTVLLLVTPFLAAAWSLHP" sig_peptide 63..134 /gene="CD59" /note="G00-119-769" 3'UTR 471..577 /gene="CD59" /note="G00-119-769" polyA_site 560..565 /gene="CD59" BASE COUNT 147 a 140 c 131 g 160 t ORIGIN 1 ctttagcacc agttggtgta ggagttgaga cctacttcac agtagttctg tggacaatca 61 caatgggaat ccaaggaggg tctgtcctgt tcgggctgct gctcgtcctg gctgtcttct 121 gccattcagg tcatagcctg cagtgctaca actgtcctaa cccaactgct gactgcaaaa 181 cagccgtcaa ttgttcatct gattttgatg cgtgtctcat taccaaagct gggttacaag 241 tgtataacaa gtgttggaag tttgagcatt gcaatttcaa cgacgtcaca acccgcttga 301 gggaaaatga gctaacgtac tactgctgca agaaggacct gtgtaacttt aacgaacagc 361 ttgaaaatgg tgggacatcc ttatcagaga aaacagttct tctgctggtg actccatttc 421 tggcagcagc ctggagcctt catccctaag tcaacaccag gagagcttct cccaaactcc 481 ccgttcctgc gtagtccgct ttctcttgct gccacattct aaaggcttga tattttccaa 541 atggatcctg ttgggaaaga ataaaattag cttgagca //