LOCUS       HUMIGKBZ                 420 bp    mRNA    linear   HUM 28-OCT-1994
DEFINITION  Human Ig rearranged light-chain mRNA V region.
ACCESSION   M74022
VERSION     M74022.1
KEYWORDS    V-region; anti-I; immunoglobulin light chain; processed gene.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 420)
  AUTHORS   Silberstein,L.E., Jefferies,L.C., Goldman,J., Friedman,D.,
            Moore,J.S., Nowell,P.C., Roelcke,D., Pruzanski,W., Roudier,J. and
            Silverman,G.J.
  TITLE     Variable region gene analysis of pathologic human autoantibodies to
            the related i and I red blood cell antigens
  JOURNAL   Blood 78 (9), 2372-2386 (1991)
   PUBMED   1657249
COMMENT     Original source text: Homo sapiens cDNA to mRNA.
FEATURES             Location/Qualifiers
     source          1..420
                     /db_xref="H-InvDB:HIT000196295"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
     CDS             1..420
                     /note="related to HumvK328"
                     /codon_start=1
                     /product="immunoglobulin light chain variable region"
                     /protein_id="AAA51018.1"
                     /translation="ETPAQLLFLLLLWLPDTTGEIVMTQSPATLSVSPGERATLSCRA
                     SQSLNSNLAWYQQKPGQAPRLLMYDISTRATGIPARFSGSGSGTDFTLTISSLQSEDF
                     AVYYCQQYNTWPPLTFGGGTKVEIKRTVAAPSVFIFPP"
     sig_peptide     1..57
     V_region        58..420
                     /product="immunoglobulin light chain variable region"
BASE COUNT           95 a          133 c           97 g           95 t
ORIGIN      
        1 gaaaccccag cccagcttct cttcctcctg ctactctggc tcccagatac cactggagaa
       61 atagtgatga cgcagtctcc agccaccctg tctgtgtctc caggggaaag agccaccctc
      121 tcctgcaggg ccagtcagag tcttaacagc aacttagcct ggtaccagca gaaacctggc
      181 caggctccca ggctcctcat gtatgatata tctaccaggg ccactggcat cccagccaga
      241 ttcagtggca gtgggtctgg gacagacttc actctcacca tcagcagcct gcagtctgaa
      301 gattttgcag tttattactg tcagcagtat aatacctggc ctccgctcac tttcggcgga
      361 gggaccaagg tggagatcaa acgaactgtg gctgcaccat ctgtcttcat cttcccgcca
//