LOCUS HUMIGKBZ 420 bp mRNA linear HUM 28-OCT-1994 DEFINITION Human Ig rearranged light-chain mRNA V region. ACCESSION M74022 VERSION M74022.1 KEYWORDS V-region; anti-I; immunoglobulin light chain; processed gene. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 420) AUTHORS Silberstein,L.E., Jefferies,L.C., Goldman,J., Friedman,D., Moore,J.S., Nowell,P.C., Roelcke,D., Pruzanski,W., Roudier,J. and Silverman,G.J. TITLE Variable region gene analysis of pathologic human autoantibodies to the related i and I red blood cell antigens JOURNAL Blood 78 (9), 2372-2386 (1991) PUBMED 1657249 COMMENT Original source text: Homo sapiens cDNA to mRNA. FEATURES Location/Qualifiers source 1..420 /db_xref="H-InvDB:HIT000196295" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" CDS 1..420 /note="related to HumvK328" /codon_start=1 /product="immunoglobulin light chain variable region" /protein_id="AAA51018.1" /translation="ETPAQLLFLLLLWLPDTTGEIVMTQSPATLSVSPGERATLSCRA SQSLNSNLAWYQQKPGQAPRLLMYDISTRATGIPARFSGSGSGTDFTLTISSLQSEDF AVYYCQQYNTWPPLTFGGGTKVEIKRTVAAPSVFIFPP" sig_peptide 1..57 V_region 58..420 /product="immunoglobulin light chain variable region" BASE COUNT 95 a 133 c 97 g 95 t ORIGIN 1 gaaaccccag cccagcttct cttcctcctg ctactctggc tcccagatac cactggagaa 61 atagtgatga cgcagtctcc agccaccctg tctgtgtctc caggggaaag agccaccctc 121 tcctgcaggg ccagtcagag tcttaacagc aacttagcct ggtaccagca gaaacctggc 181 caggctccca ggctcctcat gtatgatata tctaccaggg ccactggcat cccagccaga 241 ttcagtggca gtgggtctgg gacagacttc actctcacca tcagcagcct gcagtctgaa 301 gattttgcag tttattactg tcagcagtat aatacctggc ctccgctcac tttcggcgga 361 gggaccaagg tggagatcaa acgaactgtg gctgcaccat ctgtcttcat cttcccgcca //