LOCUS HUMCALCI 681 bp mRNA linear HUM 31-DEC-1994 DEFINITION Human calcitonin (CALCA) mRNA, complete cds. ACCESSION M64486 VERSION M64486.1 KEYWORDS calcitonin. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 681) AUTHORS Minvielle,S., Giscard-Dartevelle,S., Cohen,R., Taboulet,J., Labye,F., Jullienne,A., Rivaille,P., Milhaud,G., Moukhtar,M.S. and Lasmoles,F. TITLE A novel calcitonin carboxyl-terminal peptide produced in medullary thyroid carcinoma by alternative RNA processing of the calcitonin/calcitonin gene-related peptide gene JOURNAL J. Biol. Chem. 266 (36), 24627-24631 (1991) PUBMED 1761559 COMMENT Original source text: Homo sapiens medullary thyroid carcinoma cDNA to mRNA. FEATURES Location/Qualifiers source 1..681 /db_xref="H-InvDB:HIT000196131" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /map="11p15.2-p15.1" /tissue_type="medullary thyroid carcinoma" gene 1..681 /gene="CALCA" mRNA 1..681 /gene="CALCA" /experiment="experimental evidence, no additional details recorded" CDS 40..465 /gene="CALCA" /experiment="experimental evidence, no additional details recorded" /codon_start=1 /product="calcitonin" /protein_id="AAA58403.1" /translation="MGFQKFSPFLALSILVLLQAGSLHAAPFRSALESSPADPATLSE DEARLLLAALVQDYVQMKASELEQEQEREGSSLDSPRSKRCGNLSTCMLGTYTQDFNK FHTFPQTAIGVGAPGKKRDMSSDLERDHRPHNHCPEESL" sig_peptide 40..114 /gene="CALCA" /experiment="experimental evidence, no additional details recorded" mat_peptide 292..390 /gene="CALCA" /product="calcitonin" /experiment="experimental evidence, no additional details recorded" misc_feature 115..285 /gene="CALCA" /experiment="experimental evidence, no additional details recorded" /note="pro-peptide; N-terminal peptide" misc_feature 400..462 /gene="CALCA" /experiment="experimental evidence, no additional details recorded" /note="pro-peptide; C-terminal peptide" BASE COUNT 167 a 187 c 192 g 135 t ORIGIN 1 gcctctctga tccaagccac ctcccgccag agaggtgtca tgggcttcca aaagttctcc 61 cccttcctgg ctctcagcat cttggtcctg ttgcaggcag gcagcctcca tgcagcacca 121 ttcaggtctg ccctggagag cagcccagca gacccggcca cgctcagtga ggacgaagcg 181 cgcctcctgc tggctgcact ggtgcaggac tatgtgcaga tgaaggccag tgagctggag 241 caggagcaag agagagaggg ctccagcctg gacagcccca gatctaagcg gtgcggtaat 301 ctgagtactt gcatgctggg cacatacacg caggacttca acaagtttca cacgttcccc 361 caaactgcaa ttggggttgg agcacctgga aagaaaaggg atatgtccag cgacttggag 421 agagaccatc gccctcataa tcattgccca gaagagagcc tgtgacactg ccacctgtgt 481 gactcatcgg ctggcaggct tgctgagcag atcagggggt gtggtgaaga acaactttgt 541 gcccaccaat gtgggttcca aagcctttgg caggcgccgc agggaccttc aagcctgagc 601 agctgaatga ctcaagaagg tcacaataaa gctgaactcc ttttaatgtg taatgaaagc 661 aatttgtagg aaaggctcca t //