LOCUS       HUMCALCI                 681 bp    mRNA    linear   HUM 31-DEC-1994
DEFINITION  Human calcitonin (CALCA) mRNA, complete cds.
ACCESSION   M64486
VERSION     M64486.1
KEYWORDS    calcitonin.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 681)
  AUTHORS   Minvielle,S., Giscard-Dartevelle,S., Cohen,R., Taboulet,J.,
            Labye,F., Jullienne,A., Rivaille,P., Milhaud,G., Moukhtar,M.S. and
            Lasmoles,F.
  TITLE     A novel calcitonin carboxyl-terminal peptide produced in medullary
            thyroid carcinoma by alternative RNA processing of the
            calcitonin/calcitonin gene-related peptide gene
  JOURNAL   J. Biol. Chem. 266 (36), 24627-24631 (1991)
   PUBMED   1761559
COMMENT     Original source text: Homo sapiens medullary thyroid carcinoma cDNA
            to mRNA.
FEATURES             Location/Qualifiers
     source          1..681
                     /db_xref="H-InvDB:HIT000196131"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /map="11p15.2-p15.1"
                     /tissue_type="medullary thyroid carcinoma"
     gene            1..681
                     /gene="CALCA"
     mRNA            1..681
                     /gene="CALCA"
                     /experiment="experimental evidence, no additional details
                     recorded"
     CDS             40..465
                     /gene="CALCA"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /codon_start=1
                     /product="calcitonin"
                     /protein_id="AAA58403.1"
                     /translation="MGFQKFSPFLALSILVLLQAGSLHAAPFRSALESSPADPATLSE
                     DEARLLLAALVQDYVQMKASELEQEQEREGSSLDSPRSKRCGNLSTCMLGTYTQDFNK
                     FHTFPQTAIGVGAPGKKRDMSSDLERDHRPHNHCPEESL"
     sig_peptide     40..114
                     /gene="CALCA"
                     /experiment="experimental evidence, no additional details
                     recorded"
     mat_peptide     292..390
                     /gene="CALCA"
                     /product="calcitonin"
                     /experiment="experimental evidence, no additional details
                     recorded"
     misc_feature    115..285
                     /gene="CALCA"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="pro-peptide; N-terminal peptide"
     misc_feature    400..462
                     /gene="CALCA"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="pro-peptide; C-terminal peptide"
BASE COUNT          167 a          187 c          192 g          135 t
ORIGIN      
        1 gcctctctga tccaagccac ctcccgccag agaggtgtca tgggcttcca aaagttctcc
       61 cccttcctgg ctctcagcat cttggtcctg ttgcaggcag gcagcctcca tgcagcacca
      121 ttcaggtctg ccctggagag cagcccagca gacccggcca cgctcagtga ggacgaagcg
      181 cgcctcctgc tggctgcact ggtgcaggac tatgtgcaga tgaaggccag tgagctggag
      241 caggagcaag agagagaggg ctccagcctg gacagcccca gatctaagcg gtgcggtaat
      301 ctgagtactt gcatgctggg cacatacacg caggacttca acaagtttca cacgttcccc
      361 caaactgcaa ttggggttgg agcacctgga aagaaaaggg atatgtccag cgacttggag
      421 agagaccatc gccctcataa tcattgccca gaagagagcc tgtgacactg ccacctgtgt
      481 gactcatcgg ctggcaggct tgctgagcag atcagggggt gtggtgaaga acaactttgt
      541 gcccaccaat gtgggttcca aagcctttgg caggcgccgc agggaccttc aagcctgagc
      601 agctgaatga ctcaagaagg tcacaataaa gctgaactcc ttttaatgtg taatgaaagc
      661 aatttgtagg aaaggctcca t
//