LOCUS HUMTTP 1684 bp mRNA linear HUM 14-JAN-1995 DEFINITION Human tristetraproline (TTP) mRNA, complete cds. ACCESSION M63625 VERSION M63625.1 KEYWORDS tristetraproline. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 1684) AUTHORS Taylor,G.A., Lai,W.S., Oakey,R.J., Seldin,M.F., Shows,T.B., Eddy,R.L. Jr. and Blackshear,P.J. TITLE The human TTP protein: sequence, alignment with related proteins, and chromosomal localization of the mouse and human genes JOURNAL Nucleic Acids Res. 19 (12), 3454 (1991) PUBMED 2062660 COMMENT Original source text: Homo sapiens (tissue library: HeLa cDNA phage) cervix cDNA to mRNA. FEATURES Location/Qualifiers source 1..1684 /db_xref="H-InvDB:HIT000196081" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /map="19q." /cell_type="epitheloid carcinoma" /tissue_type="cervix" /tissue_lib="HeLa cDNA phage" gene 1..1684 /gene="TTP" CDS 10..990 /gene="TTP" /codon_start=1 /product="tristetraproline" /protein_id="AAA61240.1" /translation="MDLTAIYESLLSLSPDVPVPSDHGGTESSPGWGSSGPWSLSPSD SSPSGVTSRLPGRSTSLVEGRSCGWVPPPPGFAPLAPRLGPELSPSPTSPTATSTTPS RYKTELCRTFSESGRCRYGAKCQFAHGLGELRQANRHPKYKTELCHKFYLQGRCPYGS RCHFIHNPSEDLAAPGHPPVLRQSISFSGLPSGRRTSPPPPGLAGPSLSSSSFSPSSS PPPPGDLPLSPSAFSAAPGTPLARRDPTPVCCPSCRRATPISVWGPLGGLVRTPSVQS LGSDPDEYASSGSSLGGSDSPVFEAGVFAPPQPVAAPRRLPIFNRISVSE" regulatory 1243..1247 /regulatory_class="other" /gene="TTP" /standard_name="mRNA degradation signal 1" /note="other" regulatory 1484..1488 /regulatory_class="other" /gene="TTP" /standard_name="mRNA degradation signal 2" /note="other" regulatory 1499..1503 /regulatory_class="other" /gene="TTP" /standard_name="mRNA degradation signal 3" /note="other" regulatory 1524..1528 /regulatory_class="other" /gene="TTP" /standard_name="mRNA degradation signal 4" /note="other" regulatory 1622..1626 /regulatory_class="other" /gene="TTP" /standard_name="mRNA degradation signal 5" /note="other" regulatory 1679..1684 /regulatory_class="polyA_signal_sequence" /gene="TTP" BASE COUNT 318 a 568 c 394 g 404 t ORIGIN 1 cgttacacca tggatctgac tgccatctac gagagcctcc tgtcgctgag ccctgacgtg 61 cccgtgccat ccgaccatgg agggactgag tccagcccag gctggggctc ctcgggaccc 121 tggagcctga gcccctccga ctccagcccg tctggggtca cctcccgcct gcctggccgc 181 tccaccagcc tagtggaggg ccgcagctgt ggctgggtgc ccccaccccc tggcttcgca 241 ccgctggctc cccgcctggg ccctgagctg tcaccctcac ccacttcgcc cactgcaacc 301 tccaccaccc cctcgcgcta caagactgag ctatgtcgga ccttctcaga gagtgggcgc 361 tgccgctacg gggccaagtg ccagtttgcc catggcctgg gcgagctgcg ccaggccaat 421 cgccacccca aatacaagac ggaactctgt cacaagttct acctccaggg ccgctgcccc 481 tacggctctc gctgccactt catccacaac cctagcgaag acctggcggc cccgggccac 541 cctcctgtgc ttcgccagag catcagcttc tccggcctgc cctctggccg ccggacctca 601 ccaccaccac caggcctggc cggcccttcc ctgtcctcca gctccttctc gccctccagc 661 tccccaccac cacctgggga ccttccactg tcaccctctg ccttctctgc tgcccctggc 721 acccccctgg ctcgaagaga ccccacccca gtctgttgcc cctcctgccg aagggccact 781 cctatcagcg tctgggggcc cttgggtggc ctggttcgga ccccctctgt acagtccctg 841 ggatccgacc ctgatgaata tgccagcagc ggcagcagcc tggggggctc tgactctccc 901 gtcttcgagg cgggagtttt tgcaccaccc cagcccgtgg cagccccccg gcgactcccc 961 atcttcaatc gcatctctgt ttctgagtga caaagtgact gcccggtcag atcagctgga 1021 tctcagcggg gagccacgtc tcttgcactg tggtctctgc atggacccca gggctgtggg 1081 gacttggggg acagtaatca agtaatcccc ttttccagaa tgcattaacc cactcccctg 1141 acctcacgct ggggcaggtc cccaagtgtg caagctcagt attcatgatg gtgggggatg 1201 gagtgtcttc cgaggttctt gggggaaaaa aaattgtagc atatttaagg gaggcaatga 1261 accctctccc ccacctcttc cctgcccaaa tctgtctcct agaatcttat gtgctgtgaa 1321 taataggcct tcactgcccc tccagttttt atagacctga ggttccagtg tctcctggta 1381 actggaacct ctcctgaggg ggaatcctgg tgctcaaatt accctccaaa agcaagtgac 1441 caaagccgtt gccaaacccc acccataaat caatgggccc tttatttatg acgactttat 1501 ttattctaat atgattttat agtatttata tatattgggt cgtctgcttc ccttgtattt 1561 ttcttccttt ttttgtaata ttgaaaacga cgatataatt attataagta gactataata 1621 tatttagtaa tatatattat taccttaaaa gtctattttt gtgttttggg catttttaaa 1681 taaa //