LOCUS       HUMTTP                  1684 bp    mRNA    linear   HUM 14-JAN-1995
DEFINITION  Human tristetraproline (TTP) mRNA, complete cds.
ACCESSION   M63625
VERSION     M63625.1
KEYWORDS    tristetraproline.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1684)
  AUTHORS   Taylor,G.A., Lai,W.S., Oakey,R.J., Seldin,M.F., Shows,T.B.,
            Eddy,R.L. Jr. and Blackshear,P.J.
  TITLE     The human TTP protein: sequence, alignment with related proteins,
            and chromosomal localization of the mouse and human genes
  JOURNAL   Nucleic Acids Res. 19 (12), 3454 (1991)
   PUBMED   2062660
COMMENT     Original source text: Homo sapiens (tissue library: HeLa cDNA
            phage) cervix cDNA to mRNA.
FEATURES             Location/Qualifiers
     source          1..1684
                     /db_xref="H-InvDB:HIT000196081"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /map="19q."
                     /cell_type="epitheloid carcinoma"
                     /tissue_type="cervix"
                     /tissue_lib="HeLa cDNA phage"
     gene            1..1684
                     /gene="TTP"
     CDS             10..990
                     /gene="TTP"
                     /codon_start=1
                     /product="tristetraproline"
                     /protein_id="AAA61240.1"
                     /translation="MDLTAIYESLLSLSPDVPVPSDHGGTESSPGWGSSGPWSLSPSD
                     SSPSGVTSRLPGRSTSLVEGRSCGWVPPPPGFAPLAPRLGPELSPSPTSPTATSTTPS
                     RYKTELCRTFSESGRCRYGAKCQFAHGLGELRQANRHPKYKTELCHKFYLQGRCPYGS
                     RCHFIHNPSEDLAAPGHPPVLRQSISFSGLPSGRRTSPPPPGLAGPSLSSSSFSPSSS
                     PPPPGDLPLSPSAFSAAPGTPLARRDPTPVCCPSCRRATPISVWGPLGGLVRTPSVQS
                     LGSDPDEYASSGSSLGGSDSPVFEAGVFAPPQPVAAPRRLPIFNRISVSE"
     regulatory      1243..1247
                     /regulatory_class="other"
                     /gene="TTP"
                     /standard_name="mRNA degradation signal 1"
                     /note="other"
     regulatory      1484..1488
                     /regulatory_class="other"
                     /gene="TTP"
                     /standard_name="mRNA degradation signal 2"
                     /note="other"
     regulatory      1499..1503
                     /regulatory_class="other"
                     /gene="TTP"
                     /standard_name="mRNA degradation signal 3"
                     /note="other"
     regulatory      1524..1528
                     /regulatory_class="other"
                     /gene="TTP"
                     /standard_name="mRNA degradation signal 4"
                     /note="other"
     regulatory      1622..1626
                     /regulatory_class="other"
                     /gene="TTP"
                     /standard_name="mRNA degradation signal 5"
                     /note="other"
     regulatory      1679..1684
                     /regulatory_class="polyA_signal_sequence"
                     /gene="TTP"
BASE COUNT          318 a          568 c          394 g          404 t
ORIGIN      
        1 cgttacacca tggatctgac tgccatctac gagagcctcc tgtcgctgag ccctgacgtg
       61 cccgtgccat ccgaccatgg agggactgag tccagcccag gctggggctc ctcgggaccc
      121 tggagcctga gcccctccga ctccagcccg tctggggtca cctcccgcct gcctggccgc
      181 tccaccagcc tagtggaggg ccgcagctgt ggctgggtgc ccccaccccc tggcttcgca
      241 ccgctggctc cccgcctggg ccctgagctg tcaccctcac ccacttcgcc cactgcaacc
      301 tccaccaccc cctcgcgcta caagactgag ctatgtcgga ccttctcaga gagtgggcgc
      361 tgccgctacg gggccaagtg ccagtttgcc catggcctgg gcgagctgcg ccaggccaat
      421 cgccacccca aatacaagac ggaactctgt cacaagttct acctccaggg ccgctgcccc
      481 tacggctctc gctgccactt catccacaac cctagcgaag acctggcggc cccgggccac
      541 cctcctgtgc ttcgccagag catcagcttc tccggcctgc cctctggccg ccggacctca
      601 ccaccaccac caggcctggc cggcccttcc ctgtcctcca gctccttctc gccctccagc
      661 tccccaccac cacctgggga ccttccactg tcaccctctg ccttctctgc tgcccctggc
      721 acccccctgg ctcgaagaga ccccacccca gtctgttgcc cctcctgccg aagggccact
      781 cctatcagcg tctgggggcc cttgggtggc ctggttcgga ccccctctgt acagtccctg
      841 ggatccgacc ctgatgaata tgccagcagc ggcagcagcc tggggggctc tgactctccc
      901 gtcttcgagg cgggagtttt tgcaccaccc cagcccgtgg cagccccccg gcgactcccc
      961 atcttcaatc gcatctctgt ttctgagtga caaagtgact gcccggtcag atcagctgga
     1021 tctcagcggg gagccacgtc tcttgcactg tggtctctgc atggacccca gggctgtggg
     1081 gacttggggg acagtaatca agtaatcccc ttttccagaa tgcattaacc cactcccctg
     1141 acctcacgct ggggcaggtc cccaagtgtg caagctcagt attcatgatg gtgggggatg
     1201 gagtgtcttc cgaggttctt gggggaaaaa aaattgtagc atatttaagg gaggcaatga
     1261 accctctccc ccacctcttc cctgcccaaa tctgtctcct agaatcttat gtgctgtgaa
     1321 taataggcct tcactgcccc tccagttttt atagacctga ggttccagtg tctcctggta
     1381 actggaacct ctcctgaggg ggaatcctgg tgctcaaatt accctccaaa agcaagtgac
     1441 caaagccgtt gccaaacccc acccataaat caatgggccc tttatttatg acgactttat
     1501 ttattctaat atgattttat agtatttata tatattgggt cgtctgcttc ccttgtattt
     1561 ttcttccttt ttttgtaata ttgaaaacga cgatataatt attataagta gactataata
     1621 tatttagtaa tatatattat taccttaaaa gtctattttt gtgttttggg catttttaaa
     1681 taaa
//