LOCUS       HUMVIP89                 386 bp    mRNA    linear   HUM 07-MAR-1995
DEFINITION  Human vasoactive intestinal peptide and peptide histidine
            isoleucine mRNA, 3' end.
ACCESSION   M54930 M38563
VERSION     M54930.1
KEYWORDS    peptide histidian isoleucine; vasoactive intestinal peptide;
            vipoma.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 386)
  AUTHORS   Bloom,S.R., Christofides,N.D., Delamarter,J., Buell,G.,
            Kawashima,E. and Polak,J.M.
  TITLE     Diarrhoea in vipoma patients associated with cosecretion of a
            second active peptide (peptide histidine isoleucine) explained by
            single coding gene
  JOURNAL   Lancet 2 (8360), 1163-1165 (1983)
   PUBMED   6139527
COMMENT     Original source text: Human pancreatic tumor cDNA to mRNA, clone
            pVIP-3.
FEATURES             Location/Qualifiers
     source          1..386
                     /db_xref="H-InvDB:HIT000195754"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /map="6q24-q27"
                     /clone="pVIP-3"
                     /tissue_type="pancreatic tumor"
     gene            1..386
                     /gene="VIP"
     CDS             <1..366
                     /gene="VIP"
                     /codon_start=1
                     /product="vasoactive intestinal peptide"
                     /protein_id="AAA63268.1"
                     /db_xref="GDB:G00-120-490"
                     /translation="DQVSLKEDIDMLQNALAENDTPYYDVSRNARHADGVFTSDFSKL
                     LGQLSAKKYLESLMGKRVSSNISEDPVPVKRHSDAVFTDNYTRLRKQMAVKKYLNSIL
                     NGKRSSEGESPDFPEELEK"
     mat_peptide     94..174
                     /gene="VIP"
                     /product="peptide histidine isoleucine"
                     /note="G00-120-490"
     mat_peptide     226..309
                     /gene="VIP"
                     /product="vasoactive intestinal peptide"
                     /note="G00-120-490"
BASE COUNT          133 a           85 c           75 g           93 t
ORIGIN      
        1 gatcaagttt cattaaaaga agacattgac atgttgcaaa atgcattagc tgaaaatgac
       61 acaccctatt atgatgtatc cagaaatgcc aggcatgctg atggagtttt caccagtgac
      121 ttcagtaaac tcttgggtca actttctgcc aaaaagtacc ttgagtctct tatgggaaaa
      181 cgtgttagca gtaacatctc agaagaccct gtaccagtca aacgtcactc agatgcagtc
      241 ttcactgaca actatacccg ccttagaaaa caaatggctg taaagaaata tttgaactca
      301 attctgaatg gaaagaggag cagtgaggga gaatctcccg actttccaga agagttagaa
      361 aaatgatgaa aaaacccccc cccccc
//