LOCUS HUMVIP89 386 bp mRNA linear HUM 07-MAR-1995 DEFINITION Human vasoactive intestinal peptide and peptide histidine isoleucine mRNA, 3' end. ACCESSION M54930 M38563 VERSION M54930.1 KEYWORDS peptide histidian isoleucine; vasoactive intestinal peptide; vipoma. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 386) AUTHORS Bloom,S.R., Christofides,N.D., Delamarter,J., Buell,G., Kawashima,E. and Polak,J.M. TITLE Diarrhoea in vipoma patients associated with cosecretion of a second active peptide (peptide histidine isoleucine) explained by single coding gene JOURNAL Lancet 2 (8360), 1163-1165 (1983) PUBMED 6139527 COMMENT Original source text: Human pancreatic tumor cDNA to mRNA, clone pVIP-3. FEATURES Location/Qualifiers source 1..386 /db_xref="H-InvDB:HIT000195754" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /map="6q24-q27" /clone="pVIP-3" /tissue_type="pancreatic tumor" gene 1..386 /gene="VIP" CDS <1..366 /gene="VIP" /codon_start=1 /product="vasoactive intestinal peptide" /protein_id="AAA63268.1" /db_xref="GDB:G00-120-490" /translation="DQVSLKEDIDMLQNALAENDTPYYDVSRNARHADGVFTSDFSKL LGQLSAKKYLESLMGKRVSSNISEDPVPVKRHSDAVFTDNYTRLRKQMAVKKYLNSIL NGKRSSEGESPDFPEELEK" mat_peptide 94..174 /gene="VIP" /product="peptide histidine isoleucine" /note="G00-120-490" mat_peptide 226..309 /gene="VIP" /product="vasoactive intestinal peptide" /note="G00-120-490" BASE COUNT 133 a 85 c 75 g 93 t ORIGIN 1 gatcaagttt cattaaaaga agacattgac atgttgcaaa atgcattagc tgaaaatgac 61 acaccctatt atgatgtatc cagaaatgcc aggcatgctg atggagtttt caccagtgac 121 ttcagtaaac tcttgggtca actttctgcc aaaaagtacc ttgagtctct tatgggaaaa 181 cgtgttagca gtaacatctc agaagaccct gtaccagtca aacgtcactc agatgcagtc 241 ttcactgaca actatacccg ccttagaaaa caaatggctg taaagaaata tttgaactca 301 attctgaatg gaaagaggag cagtgaggga gaatctcccg actttccaga agagttagaa 361 aaatgatgaa aaaacccccc cccccc //