LOCUS HUMIGKCZ 424 bp mRNA linear HUM 04-JAN-1995 DEFINITION Homo sapiens Ig kappa chain VJ region mRNA, partial cds. ACCESSION M38267 VERSION M38267.1 KEYWORDS immunoglobulin-kappa. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 424) AUTHORS Cogne,M., Preud'homme,J.L., Bauwens,M., Touchard,G. and Aucouturier,P. TITLE Structure of a monoclonal kappa chain of the V kappa IV subgroup in the kidney and plasma cells in light chain deposition disease JOURNAL J. Clin. Invest. 87 (6), 2186-2190 (1991) PUBMED 1904072 COMMENT Original source text: Human, cDNA to mRNA. Draft entry and computer-readable sequence for [Unpublished (1990)] kindly submitted by M.C.C.Cogn, 31-AUG-1990. CNRS URA 1172 Lab. Immunologie Molculaire Facult des Sciences F-86022 Poitiers France. FEATURES Location/Qualifiers source 1..424 /db_xref="H-InvDB:HIT000195742" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /map="2p12" gene 1..424 /gene="IGKV" mRNA <1..424 /gene="IGKV" /product="immunoglobulin kappa-chain VJ region" /note="Ig kappa chain responsible for light chain depostion disease; G00-119-341" CDS 22..424 /gene="IGKV" /note="Ig kappa chain responsible for light chain depostion disease" /codon_start=1 /product="immunoglobulin kappa-chain VJ region" /protein_id="AAA58923.1" /db_xref="GDB:G00-119-341" /translation="MVLQTQVFISLLLWISGAHGDIVMTQSPDSLAVSLGERATINCK SSLSVFFSPNNKNYLAWYQQKPGQPPKLLIYWASTRESGVPDRFSGSGSGTNFTLTIS RLQAEDVAVYYCQQYYTTLSWTFGQGTKVEIK" sig_peptide 22..81 /gene="IGKV" /note="Ig kappa chain responsible for light chain depostion disease; G00-119-341" mat_peptide 82..>423 /gene="IGKV" /product="immunoglobulin kappa-chain VJ region" /note="Ig kappa chain responsible for light chain depostion disease; G00-119-341" BASE COUNT 95 a 117 c 111 g 101 t ORIGIN 1 caggcaggca ggggcagcaa gatggtgttg cagacccagg tcttcatttc tctgttgctc 61 tggatctctg gtgcccacgg ggacatcgtg atgacccagt ctccagactc cctggctgtg 121 tctctgggcg agagggccac catcaactgc aagtccagcc tgagtgtttt cttcagcccc 181 aacaataaga actacttagc ttggtatcag cagaaaccag gacagcctcc taagttgctc 241 atttactggg catctacccg ggaatccggg gtccctgacc gattcagtgg cagcggctct 301 gggacaaatt tcactctcac catcagccgc ctgcaggctg aggatgtggc agtttattac 361 tgtcagcaat attatactac tctttcgtgg acgttcggcc aagggaccaa ggtggaaatc 421 aaac //