LOCUS       HUMIGKCZ                 424 bp    mRNA    linear   HUM 04-JAN-1995
DEFINITION  Homo sapiens Ig kappa chain VJ region mRNA, partial cds.
ACCESSION   M38267
VERSION     M38267.1
KEYWORDS    immunoglobulin-kappa.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 424)
  AUTHORS   Cogne,M., Preud'homme,J.L., Bauwens,M., Touchard,G. and
            Aucouturier,P.
  TITLE     Structure of a monoclonal kappa chain of the V kappa IV subgroup in
            the kidney and plasma cells in light chain deposition disease
  JOURNAL   J. Clin. Invest. 87 (6), 2186-2190 (1991)
   PUBMED   1904072
COMMENT     Original source text: Human, cDNA to mRNA.
            Draft entry and computer-readable sequence for [Unpublished (1990)]
            kindly submitted
            by M.C.C.Cogn, 31-AUG-1990.
               CNRS URA 1172
               Lab. Immunologie Molculaire
               Facult des Sciences
               F-86022 Poitiers France.
FEATURES             Location/Qualifiers
     source          1..424
                     /db_xref="H-InvDB:HIT000195742"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /map="2p12"
     gene            1..424
                     /gene="IGKV"
     mRNA            <1..424
                     /gene="IGKV"
                     /product="immunoglobulin kappa-chain VJ region"
                     /note="Ig kappa chain responsible for light chain
                     depostion disease; G00-119-341"
     CDS             22..424
                     /gene="IGKV"
                     /note="Ig kappa chain responsible for light chain
                     depostion disease"
                     /codon_start=1
                     /product="immunoglobulin kappa-chain VJ region"
                     /protein_id="AAA58923.1"
                     /db_xref="GDB:G00-119-341"
                     /translation="MVLQTQVFISLLLWISGAHGDIVMTQSPDSLAVSLGERATINCK
                     SSLSVFFSPNNKNYLAWYQQKPGQPPKLLIYWASTRESGVPDRFSGSGSGTNFTLTIS
                     RLQAEDVAVYYCQQYYTTLSWTFGQGTKVEIK"
     sig_peptide     22..81
                     /gene="IGKV"
                     /note="Ig kappa chain responsible for light chain
                     depostion disease; G00-119-341"
     mat_peptide     82..>423
                     /gene="IGKV"
                     /product="immunoglobulin kappa-chain VJ region"
                     /note="Ig kappa chain responsible for light chain
                     depostion disease; G00-119-341"
BASE COUNT           95 a          117 c          111 g          101 t
ORIGIN      
        1 caggcaggca ggggcagcaa gatggtgttg cagacccagg tcttcatttc tctgttgctc
       61 tggatctctg gtgcccacgg ggacatcgtg atgacccagt ctccagactc cctggctgtg
      121 tctctgggcg agagggccac catcaactgc aagtccagcc tgagtgtttt cttcagcccc
      181 aacaataaga actacttagc ttggtatcag cagaaaccag gacagcctcc taagttgctc
      241 atttactggg catctacccg ggaatccggg gtccctgacc gattcagtgg cagcggctct
      301 gggacaaatt tcactctcac catcagccgc ctgcaggctg aggatgtggc agtttattac
      361 tgtcagcaat attatactac tctttcgtgg acgttcggcc aagggaccaa ggtggaaatc
      421 aaac
//