LOCUS       HUMRASKI2                113 bp    mRNA    linear   HUM 27-APR-1993
DEFINITION  Human c-ras-Ki-2 activated oncogene mRNA, partial cds.
ACCESSION   M17087
VERSION     M17087.1
KEYWORDS    c-ras-Ki-2 gene.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 113)
  AUTHORS   Nardeux,P.C., Daya-Grosjean,L., Landin,R.M., Andeol,Y. and
            Suarez,H.G.
  TITLE     A c-ras-Ki oncogene is activated, amplified and overexpressed in a
            human osteosarcoma cell line
  JOURNAL   Biochem. Biophys. Res. Commun. 146 (2), 395-402 (1987)
   PUBMED   3476115
COMMENT     Original source text: Human (16 year old male) osteosarcoma cell
            line OHA, cDNA to mRNA, clone lambda-Co-1.
FEATURES             Location/Qualifiers
     source          1..113
                     /db_xref="H-InvDB:HIT000194513"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
     CDS             14..>113
                     /note="c-ras-Ki-2 protein"
                     /codon_start=1
                     /protein_id="AAA36555.1"
                     /translation="MTEYKLVVVGAVGVGKSALTIQLIQNHFVDEYD"
BASE COUNT           33 a           18 c           30 g           32 t
ORIGIN      3 bp upstream of StuI site.
        1 aggcctgctg aaaatgactg aatataaact tgtcgtagtt ggagctgttg gcgtaggcaa
       61 gagtgccttg acgatacagc taattcagaa tcattttgtg gacgaatatg atc
//