LOCUS HUMRASKI2 113 bp mRNA linear HUM 27-APR-1993 DEFINITION Human c-ras-Ki-2 activated oncogene mRNA, partial cds. ACCESSION M17087 VERSION M17087.1 KEYWORDS c-ras-Ki-2 gene. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 113) AUTHORS Nardeux,P.C., Daya-Grosjean,L., Landin,R.M., Andeol,Y. and Suarez,H.G. TITLE A c-ras-Ki oncogene is activated, amplified and overexpressed in a human osteosarcoma cell line JOURNAL Biochem. Biophys. Res. Commun. 146 (2), 395-402 (1987) PUBMED 3476115 COMMENT Original source text: Human (16 year old male) osteosarcoma cell line OHA, cDNA to mRNA, clone lambda-Co-1. FEATURES Location/Qualifiers source 1..113 /db_xref="H-InvDB:HIT000194513" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" CDS 14..>113 /note="c-ras-Ki-2 protein" /codon_start=1 /protein_id="AAA36555.1" /translation="MTEYKLVVVGAVGVGKSALTIQLIQNHFVDEYD" BASE COUNT 33 a 18 c 30 g 32 t ORIGIN 3 bp upstream of StuI site. 1 aggcctgctg aaaatgactg aatataaact tgtcgtagtt ggagctgttg gcgtaggcaa 61 gagtgccttg acgatacagc taattcagaa tcattttgtg gacgaatatg atc //