LOCUS       HUMBCL2B                 911 bp    mRNA    linear   HUM 31-OCT-1994
DEFINITION  Human B-cell leukemia/lymphoma 2 (bcl-2) proto-oncogene mRNA
            encoding bcl-2-beta protein, complete cds.
ACCESSION   M13995
VERSION     M13995.1
KEYWORDS    alternative splicing; bcl-2-beta protein; proto-oncogene.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 911)
  AUTHORS   Tsujimoto,Y. and Croce,C.M.
  TITLE     Analysis of the structure, transcripts, and protein products of
            bcl-2, the gene involved in human follicular lymphoma
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 83 (14), 5214-5218 (1986)
   PUBMED   3523487
COMMENT     Original source text: Human pre-B-cell leukemia cell line 380, cDNA
            to mRNA, clones B[15,16]; and DNA, clone lambda-18-27.
            Clean copy sequence for [1] kindly provided by Y.Tsujimoto,
            10-FEB-1987.  The bcl-2 gene is transcribed by alternative splicing
            into three mRNAs of different sizes.  It consists of at least two
            exons and encodes two proteins which only differ at their
            carboxy-terminal ends, and it is activated by translocation into
            poximity with the Ig heavy chain locus.  Both the normal and
            rearranged bcl-2 gene products are expressed in the B-cell
            leukemia/lymphoma 2 cells.  Genomic clone lambda-18-27 contained
            all the DNA sequences on the 5' of the splice site (position 732).
FEATURES             Location/Qualifiers
     source          1..911
                     /db_xref="H-InvDB:HIT000194288"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /map="18q21.3"
     gene            1..911
                     /gene="BCL2"
     mRNA            <1..>911
                     /gene="BCL2"
                     /product="bcl2a mRNA"
     CDS             147..764
                     /gene="BCL2"
                     /note="bcl2-beta protein"
                     /codon_start=1
                     /protein_id="AAA51814.1"
                     /db_xref="GDB:G00-119-031"
                     /translation="MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAP
                     APGIFSSQPGHTPHPAASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLALRQAGD
                     DFSRRYRGDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVE
                     SVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWVGASGDVSLG"
     misc_feature    732
                     /gene="BCL2"
                     /note="alternative splice donor (intron A start)"
BASE COUNT          156 a          281 c          306 g          168 t
ORIGIN      556 bp upstream of SstI site.
        1 tgattgaaga caccccctcg tccaagaatg caaagcacat ccaataaaat agctggatta
       61 taactcctct tctttctctg ggggccgtgg ggtgggagct ggggcgagag gtgccgttgg
      121 cccccgttgc ttttcctctg ggaaggatgg cgcacgctgg gagaacgggg tacgacaacc
      181 gggagatagt gatgaagtac atccattata agctgtcgca gaggggctac gagtgggatg
      241 cgggagatgt gggcgccgcg cccccggggg ccgcccccgc accgggcatc ttctcctccc
      301 agcccgggca cacgccccat ccagccgcat cccgcgaccc ggtcgccagg acctcgccgc
      361 tgcagacccc ggctgccccc ggcgccgccg cggggcctgc gctcagcccg gtgccacctg
      421 tggtccacct ggccctccgc caagccggcg acgacttctc ccgccgctac cgcggcgact
      481 tcgccgagat gtccagccag ctgcacctga cgcccttcac cgcgcgggga cgctttgcca
      541 cggtggtgga ggagctcttc agggacgggg tgaactgggg gaggattgtg gccttctttg
      601 agttcggtgg ggtcatgtgt gtggagagcg tcaaccggga gatgtcgccc ctggtggaca
      661 acatcgccct gtggatgact gagtacctga accggcacct gcacacctgg atccaggata
      721 acggaggctg ggtaggtgca tctggtgatg tgagtctggg ctgaggccac aggtccgaga
      781 tcgggggttg gagtgcgggt gggctcctgg gcaatgggag gctgtggagc cggcgaaata
      841 aaatcagagt tgttgcttcc cggcgtgtcc ctacctcctc ctctggacaa agcgttcact
      901 cccaacctga c
//