LOCUS       HUMPCCB                  469 bp    mRNA    linear   HUM 07-JAN-1995
DEFINITION  Human propionyl-CoA carboxylase beta chain mRNA.
ACCESSION   M13573
VERSION     M13573.1
KEYWORDS    biotin-dependent enzyme; propionyl-CoA carboxylase.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 469)
  AUTHORS   Lamhonwah,A.-M.
  JOURNAL   Unpublished
REFERENCE   2  (bases 3 to 469)
  AUTHORS   Lamhonwah,A.M., Barankiewicz,T.J., Willard,H.F., Mahuran,D.J.,
            Quan,F. and Gravel,R.A.
  TITLE     Isolation of cDNA clones coding for the alpha and beta chains of
            human propionyl-CoA carboxylase: chromosomal assignments and DNA
            polymorphisms associated with PCCA and PCCB genes
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 83 (13), 4864-4868 (1986)
   PUBMED   3460076
COMMENT     Original source text: Human simian virus 40 (SV40) transformed
            fibroblast (library of H.Okayama and P.Berg), cDNA to mRNA, clone
            pPCC41A2.
            [1]  revises [2].
            Computer-readable sequence for [2] kindly provided by
            A.-M.Lamhonwah, 21-OCT-1986.
            Each human seems to have two mRNAs of different lengths encoding
            the beta chain of propionyl-CoA carboxylase, one 4.5 and one 2.0 kb
            long.  Upon examining the mRNAs of different Caucasians, two
            alleles were found for each of these mRNA species.
FEATURES             Location/Qualifiers
     source          1..469
                     /db_xref="H-InvDB:HIT000194230"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /map="3q21-q22"
     gene            1..469
                     /gene="PCCB"
     CDS             <1..>467
                     /gene="PCCB"
                     /note="propionyl-CoA carboxylase beta chain (EC 6.4.1.3)"
                     /codon_start=3
                     /protein_id="AAA60036.1"
                     /db_xref="GDB:G00-119-474"
                     /translation="RECHDPSDRLVPELDTIVPLESTKAYNMVDIIHSVVDEREFFEI
                     MPNYAKNIIVGFARMNGRTVGIVGNQPKVASGCLDINSSVKGARFVRFCDAFNIPLIT
                     FVDVPGFLPGTAQEYGGIIRHGAKLLYAFAEATVPKVTVITRKAYGGAYDVMS"
BASE COUNT          114 a          108 c          113 g          134 t
ORIGIN      263 bp upstream of BanII site; chromosome 3.
        1 tccgtgagtg ccacgatccc agtgaccgtc tggttcctga gcttgacaca attgtccctt
       61 tggaatcaac caaagcctac aacatggtgg acatcataca ctctgttgtt gatgagcgtg
      121 aattttttga gatcatgccc aattatgcca agaacatcat tgttggtttt gcaagaatga
      181 atgggaggac tgttggaatt gttggcaacc aacctaaggt ggcctcagga tgcttggata
      241 ttaattcatc tgtgaaaggg gctcgttttg tcagattctg tgatgcattc aatattccac
      301 tcatcacttt tgttgatgtc cctggctttc tacctggcac agcacaggaa tacgggggca
      361 tcatccggca tggtgccaag cttctctacg catttgctga ggcaactgta cccaaagtca
      421 cagtcatcac caggaaggcc tatggaggtg cctatgatgt catgagctc
//