LOCUS HUMPCCB 469 bp mRNA linear HUM 07-JAN-1995 DEFINITION Human propionyl-CoA carboxylase beta chain mRNA. ACCESSION M13573 VERSION M13573.1 KEYWORDS biotin-dependent enzyme; propionyl-CoA carboxylase. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 469) AUTHORS Lamhonwah,A.-M. JOURNAL Unpublished REFERENCE 2 (bases 3 to 469) AUTHORS Lamhonwah,A.M., Barankiewicz,T.J., Willard,H.F., Mahuran,D.J., Quan,F. and Gravel,R.A. TITLE Isolation of cDNA clones coding for the alpha and beta chains of human propionyl-CoA carboxylase: chromosomal assignments and DNA polymorphisms associated with PCCA and PCCB genes JOURNAL Proc. Natl. Acad. Sci. U.S.A. 83 (13), 4864-4868 (1986) PUBMED 3460076 COMMENT Original source text: Human simian virus 40 (SV40) transformed fibroblast (library of H.Okayama and P.Berg), cDNA to mRNA, clone pPCC41A2. [1] revises [2]. Computer-readable sequence for [2] kindly provided by A.-M.Lamhonwah, 21-OCT-1986. Each human seems to have two mRNAs of different lengths encoding the beta chain of propionyl-CoA carboxylase, one 4.5 and one 2.0 kb long. Upon examining the mRNAs of different Caucasians, two alleles were found for each of these mRNA species. FEATURES Location/Qualifiers source 1..469 /db_xref="H-InvDB:HIT000194230" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /map="3q21-q22" gene 1..469 /gene="PCCB" CDS <1..>467 /gene="PCCB" /note="propionyl-CoA carboxylase beta chain (EC 6.4.1.3)" /codon_start=3 /protein_id="AAA60036.1" /db_xref="GDB:G00-119-474" /translation="RECHDPSDRLVPELDTIVPLESTKAYNMVDIIHSVVDEREFFEI MPNYAKNIIVGFARMNGRTVGIVGNQPKVASGCLDINSSVKGARFVRFCDAFNIPLIT FVDVPGFLPGTAQEYGGIIRHGAKLLYAFAEATVPKVTVITRKAYGGAYDVMS" BASE COUNT 114 a 108 c 113 g 134 t ORIGIN 263 bp upstream of BanII site; chromosome 3. 1 tccgtgagtg ccacgatccc agtgaccgtc tggttcctga gcttgacaca attgtccctt 61 tggaatcaac caaagcctac aacatggtgg acatcataca ctctgttgtt gatgagcgtg 121 aattttttga gatcatgccc aattatgcca agaacatcat tgttggtttt gcaagaatga 181 atgggaggac tgttggaatt gttggcaacc aacctaaggt ggcctcagga tgcttggata 241 ttaattcatc tgtgaaaggg gctcgttttg tcagattctg tgatgcattc aatattccac 301 tcatcacttt tgttgatgtc cctggctttc tacctggcac agcacaggaa tacgggggca 361 tcatccggca tggtgccaag cttctctacg catttgctga ggcaactgta cccaaagtca 421 cagtcatcac caggaaggcc tatggaggtg cctatgatgt catgagctc //