LOCUS HUMVIPR2A 1317 bp DNA linear HUM 24-MAY-1995
DEFINITION Homo sapiens vasoactive intestinal polypeptide receptor 2 (VIPR2)
mRNA, complete cds.
ACCESSION L40764
VERSION L40764.1
KEYWORDS G-protein coupled receptor; PACAP receptor; VIP receptor;
transmembrane protein; vasoactive intestinal polypeptide receptor;
vasoactive intestinal polypeptide receptor 2.
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (sites)
AUTHORS Svoboda,M., Tastenoy,M., Van Rampelbergh,J., Goossens,J.F., De
Neef,P., Waelbroeck,M. and Robberecht,P.
TITLE Molecular cloning and functional characterization of a human VIP
receptor from SUP-T1 lymphoblasts
JOURNAL Biochem. Biophys. Res. Commun. 205 (3), 1617-1624 (1994)
PUBMED 7811244
REFERENCE 2 (bases 1 to 1317)
AUTHORS Adamou,J.E., Aiyar,N., Van Horn,S. and Elshourbagy,N.A.
TITLE Cloning and functional characterization of the human vasoactive
intestinal peptide (VIP)-2 receptor
JOURNAL Biochem. Biophys. Res. Commun. 209 (2), 385-392 (1995)
PUBMED 7733904
COMMENT Original source text: Homo sapiens (clone: phVIP2-13) placenta DNA.
FEATURES Location/Qualifiers
source 1..1317
/db_xref="H-InvDB:HIT000397406"
/organism="Homo sapiens"
/mol_type="genomic DNA"
/db_xref="taxon:9606"
/clone="phVIP2-13"
/tissue_type="placenta"
gene 1..1317
/gene="VIPR2"
CDS 1..1317
/gene="VIPR2"
/standard_name="VIP-2 receptor"
/note="transmembrane domains at basepairs 384-444,
477-534, 612-681, 720-780, 840-909, 987-1044, and
1074-1140; putative"
/codon_start=1
/product="vasoactive intestinal polypeptide receptor 2"
/protein_id="AAC41756.1"
/translation="MRTLLPPALLTCWLLAPVNSIHPECRFHLEIQEEETKCTELLRS
QTEKHKACSGVWDNITCWRPANVGETVTVPCPKVFSNFYSKAGNISKNCTSDGWSETF
PDFVDACGYSDPEDESKITFYILVKAIYTLGYSVSLMSLATGSIILCLFRKLHCTRNY
IHLNLFLSFILRAISVLVKDDVLYSSSGTLHCPDQPSSWVGCKLSLVFLQYCIMANFF
WLLVEGLYLHTLLVAMLPPRRCFLAYLLIGWGLPTVCIGAWTAARLYLEDTGCWDTND
HSVPWWVIRIPILISIIVNFVLFISIIRILLQKLTSPDVGGNDQSQYKRLAKSTLLLI
PLFGVHYMVFAVFPISISSKYQILFELCLGSFQGLVVAVLYCFLNSEVQCELKRKWRS
RCPTPSASRDYRVCGSSFSHNGSEGALQFHRASRAQSFLQTETSVI"
sig_peptide 1..60
/gene="VIPR2"
/note="putative"
mat_peptide 61..1314
/gene="VIPR2"
/product="vasoactive intestinal polypeptide receptor 2"
/standard_name="VIP-2 receptor"
/note="putative"
BASE COUNT 278 a 393 c 337 g 309 t
ORIGIN
1 atgcggacgc tgctgcctcc cgcgctgctg acctgctggc tgctcgcccc cgtgaacagc
61 attcacccag aatgccgatt tcatctggaa atacaggagg aagaaacaaa atgtacagag
121 cttctgaggt ctcaaacaga aaaacacaaa gcctgcagtg gcgtctggga caacatcacg
181 tgctggcggc ctgccaatgt gggagagacc gtcacggtgc cctgcccaaa agtcttcagc
241 aatttttaca gcaaagcagg aaacataagc aaaaactgta cgagtgacgg atggtcagag
301 acgttcccag atttcgtcga tgcctgtggc tacagcgacc cggaggatga gagcaagatc
361 acgttttata ttctggtgaa ggccatttat accctgggct acagtgtctc tctgatgtct
421 cttgcaacag gaagcataat tctgtgcctc ttcaggaagc tgcactgcac caggaattac
481 atccacctga acctgttcct gtccttcatc ctgagagcca tctcagtgct ggtcaaggac
541 gacgttctct actccagctc tggcacgttg cactgccctg accagccatc ctcctgggtg
601 ggctgcaagc tgagcctggt cttcctgcag tactgcatca tggccaactt cttctggctg
661 ctggtggagg ggctctacct ccacaccctc ctggtggcca tgctcccccc tagaaggtgc
721 ttcctggcct acctcctgat cggatggggc ctccccaccg tctgcatcgg tgcatggact
781 gcggccaggc tctacttaga agacaccggt tgctgggata caaacgacca cagtgtgccc
841 tggtgggtca tacgaatacc gattttaatt tccatcatcg tcaattttgt ccttttcatt
901 agtattatac gaattttgct gcagaagtta acatccccag atgtcggcgg caacgaccag
961 tctcagtaca agaggctggc caagtccacg ctcctgctta tcccgctgtt cggcgtccac
1021 tacatggtgt ttgccgtgtt tcccatcagc atctcctcca aataccagat actgtttgag
1081 ctgtgcctcg ggtcgttcca gggcctggtg gtggccgtcc tctactgttt cctgaacagt
1141 gaggtgcagt gcgagctgaa gcgaaaatgg cgaagccggt gcccgacccc gtccgcgagc
1201 cgggattaca gggtctgcgg ttcctccttc tcccacaacg gctcggaggg cgccctgcag
1261 ttccaccgcg cgtcccgagc ccagtccttc ctgcaaacgg agacctcggt catctag
//