LOCUS       HUMIKCCL                 219 bp    mRNA    linear   HUM 10-MAY-1996
DEFINITION  Homo sapiens (clone JRSYN16) immunoglobulin kappa chain mRNA,
            partial cds.
ACCESSION   L40729
VERSION     L40729.1
KEYWORDS    immunoglobulin; kappa light chain.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 219)
  AUTHORS   Bridges,S.L. Jr., Lee,S.K., Johnson,M.L., Lavelle,J.C.,
            Fowler,P.G., Koopman,W.J. and Schroeder,H.W. Jr.
  TITLE     Somatic mutation and CDR3 lengths of immunoglobulin kappa light
            chains expressed in patients with rheumatoid arthritis and in
            normal individuals
  JOURNAL   J. Clin. Invest. 96 (2), 831-841 (1995)
   PUBMED   7635977
FEATURES             Location/Qualifiers
     source          1..219
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="JRSYN16"
                     /cell_type="B-lymphocyte"
                     /tissue_type="synovium"
                     /dev_stage="adult"
     mRNA            <1..>219
     CDS             <1..>219
                     /note="putative"
                     /citation=[1]
                     /codon_start=1
                     /product="immunoglobulin kappa chain"
                     /protein_id="AAA99381.1"
                     /translation="WYQQKPGQPPKLLIYWASTGKSGVPDRFSGSGSGTDFTLTINSL
                     QAEDVAVYYCLQFYSTPQTFGQGTKLEIK"
BASE COUNT           55 a           58 c           53 g           53 t
ORIGIN      
        1 tggtaccagc agaaaccagg acagcctcct aaactcctca tttactgggc atctaccggg
       61 aaatccgggg tccctgaccg attcagtggc agcgggtctg ggacagattt cactctcacc
      121 atcaacagcc tgcaggctga agatgtggca gtttattact gtcttcaatt ttatagtact
      181 cctcagactt ttggccaggg gaccaagctg gagatcaaa
//