LOCUS HUMIKCCL 219 bp mRNA linear HUM 10-MAY-1996 DEFINITION Homo sapiens (clone JRSYN16) immunoglobulin kappa chain mRNA, partial cds. ACCESSION L40729 VERSION L40729.1 KEYWORDS immunoglobulin; kappa light chain. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 219) AUTHORS Bridges,S.L. Jr., Lee,S.K., Johnson,M.L., Lavelle,J.C., Fowler,P.G., Koopman,W.J. and Schroeder,H.W. Jr. TITLE Somatic mutation and CDR3 lengths of immunoglobulin kappa light chains expressed in patients with rheumatoid arthritis and in normal individuals JOURNAL J. Clin. Invest. 96 (2), 831-841 (1995) PUBMED 7635977 FEATURES Location/Qualifiers source 1..219 /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /clone="JRSYN16" /cell_type="B-lymphocyte" /tissue_type="synovium" /dev_stage="adult" mRNA <1..>219 CDS <1..>219 /note="putative" /citation=[1] /codon_start=1 /product="immunoglobulin kappa chain" /protein_id="AAA99381.1" /translation="WYQQKPGQPPKLLIYWASTGKSGVPDRFSGSGSGTDFTLTINSL QAEDVAVYYCLQFYSTPQTFGQGTKLEIK" BASE COUNT 55 a 58 c 53 g 53 t ORIGIN 1 tggtaccagc agaaaccagg acagcctcct aaactcctca tttactgggc atctaccggg 61 aaatccgggg tccctgaccg attcagtggc agcgggtctg ggacagattt cactctcacc 121 atcaacagcc tgcaggctga agatgtggca gtttattact gtcttcaatt ttatagtact 181 cctcagactt ttggccaggg gaccaagctg gagatcaaa //