LOCUS HUMIKCAP 149 bp mRNA linear HUM 10-MAY-1996 DEFINITION Homo sapiens (clone BCPBL2-6) immunoglobulin kappa light chain mRNA, partial cds. ACCESSION L40681 VERSION L40681.1 KEYWORDS immunoglobulin; kappa light chain. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 149) AUTHORS Bridges,S.L. Jr., Lee,S.K., Johnson,M.L., Lavelle,J.C., Fowler,P.G., Koopman,W.J. and Schroeder,H.W. Jr. TITLE Somatic mutation and CDR3 lengths of immunoglobulin kappa light chains expressed in patients with rheumatoid arthritis and in normal individuals JOURNAL J. Clin. Invest. 96 (2), 831-841 (1995) PUBMED 7635977 FEATURES Location/Qualifiers source 1..149 /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /clone="BCPBL2-6" /cell_type="B-lymphocyte" /tissue_type="blood" /dev_stage="adult" mRNA <1..>149 CDS <1..>149 /note="putative" /citation=[1] /codon_start=3 /product="immunoglobulin kappa chain" /protein_id="AAA99331.1" /translation="PDRFSASGSGTDFTLTISSLQAEDVAIYYCQQYYTIPRTFGQGT RVEIK" BASE COUNT 38 a 38 c 37 g 36 t ORIGIN 1 tccctgaccg attcagtgcc agcgggtctg ggacagattt cactctcacc atcagcagcc 61 tgcaggctga agatgtggca atttattact gtcagcaata ttatactatt cctcggacgt 121 tcggccaagg gaccagagtg gagatcaaa //