LOCUS       HUMIKCAP                 149 bp    mRNA    linear   HUM 10-MAY-1996
DEFINITION  Homo sapiens (clone BCPBL2-6) immunoglobulin kappa light chain
            mRNA, partial cds.
ACCESSION   L40681
VERSION     L40681.1
KEYWORDS    immunoglobulin; kappa light chain.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 149)
  AUTHORS   Bridges,S.L. Jr., Lee,S.K., Johnson,M.L., Lavelle,J.C.,
            Fowler,P.G., Koopman,W.J. and Schroeder,H.W. Jr.
  TITLE     Somatic mutation and CDR3 lengths of immunoglobulin kappa light
            chains expressed in patients with rheumatoid arthritis and in
            normal individuals
  JOURNAL   J. Clin. Invest. 96 (2), 831-841 (1995)
   PUBMED   7635977
FEATURES             Location/Qualifiers
     source          1..149
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="BCPBL2-6"
                     /cell_type="B-lymphocyte"
                     /tissue_type="blood"
                     /dev_stage="adult"
     mRNA            <1..>149
     CDS             <1..>149
                     /note="putative"
                     /citation=[1]
                     /codon_start=3
                     /product="immunoglobulin kappa chain"
                     /protein_id="AAA99331.1"
                     /translation="PDRFSASGSGTDFTLTISSLQAEDVAIYYCQQYYTIPRTFGQGT
                     RVEIK"
BASE COUNT           38 a           38 c           37 g           36 t
ORIGIN      
        1 tccctgaccg attcagtgcc agcgggtctg ggacagattt cactctcacc atcagcagcc
       61 tgcaggctga agatgtggca atttattact gtcagcaata ttatactatt cctcggacgt
      121 tcggccaagg gaccagagtg gagatcaaa
//