LOCUS       HUMTRIP13M               550 bp    mRNA    linear   HUM 15-MAR-1995
DEFINITION  Homo sapiens thyroid receptor interactor (TRIP13) mRNA, partial
            cds.
ACCESSION   L40384
VERSION     L40384.1
KEYWORDS    TRIP13 gene; thyroid receptor interactor.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 550)
  AUTHORS   Lee,J.W., Choi,H.S., Gyuris,J., Brent,R. and Moore,D.D.
  TITLE     Two classes of proteins dependent on either the presence or absence
            of thyroid hormone for interaction with the thyroid hormone
            receptor
  JOURNAL   Mol. Endocrinol. 9 (2), 243-254 (1995)
   PUBMED   7776974
COMMENT     Original source text: Homo sapiens cDNA to mRNA.
            Trip 13 was isolated as interacting with the thyroid hormone recept
            or
            using the yeast 2-hybrid system.  Trip13 interacts with the
            receptor in
            cel ls grown in the absence of the hormone, but not in cells grown
            in
            its presence.  The submitted sequence extends from the 2-hybrid
            fusion
            junction and does not include the apparent C-terminus of the
            protein.
FEATURES             Location/Qualifiers
     source          1..550
                     /db_xref="H-InvDB:HIT000193607"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /cell_line="HeLa"
     gene            1..550
                     /gene="TRIP13"
     mRNA            <1..>550
                     /gene="TRIP13"
                     /product="thyroid receptor interactor"
     CDS             <1..>550
                     /gene="TRIP13"
                     /codon_start=1
                     /product="thyroid receptor interactor"
                     /protein_id="AAC41732.1"
                     /translation="GGSGRGRGDLKQALPCVAESPTVHVEVHQRGSSTAKKEDINLSV
                     RKLLNRHNIVFGDYTWTEFDEPFLTRNVQSVSIIDTELKVKDSQPIDLSACTVALHIF
                     QLNEDGPSSENLEEETENIIAANHWVLPAAEFHGLWDSLVYDVEVKSHLLDYVMTTLL
                     FSDKNVNSNLITIEGFLQALSLA"
BASE COUNT          154 a          125 c          140 g          131 t
ORIGIN      
        1 gggggcagtg gacgaggccg tggcgacctg aagcaggcgc ttccctgtgt ggccgagtcg
       61 ccaacggtcc acgtggaggt gcatcagcgc ggcagcagca ctgcaaagaa agaagacata
      121 aacctgagtg ttagaaagct actcaacaga cataatattg tgtttggcga ttacacatgg
      181 actgagtttg atgaaccttt tttgaccaga aatgtgcagt ctgtgtctat tattgacaca
      241 gaattaaagg ttaaagactc acagcccatc gatttgagtg catgcactgt tgcacttcac
      301 attttccagc tgaatgaaga tggccccagc agtgaaaatc tggaggaaga gacagaaaac
      361 ataattgcag caaatcactg ggttctacct gcagctgaat tccatgggct ttgggacagc
      421 ttggtatacg atgtggaagt caaatcccat ctcctcgatt atgtgatgac aactttactg
      481 ttttcagaca agaacgtcaa cagcaacctc atcaccatag aggggttcct ccaggccctg
      541 tctctggcag
//