LOCUS HUMTRIP13M 550 bp mRNA linear HUM 15-MAR-1995 DEFINITION Homo sapiens thyroid receptor interactor (TRIP13) mRNA, partial cds. ACCESSION L40384 VERSION L40384.1 KEYWORDS TRIP13 gene; thyroid receptor interactor. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 550) AUTHORS Lee,J.W., Choi,H.S., Gyuris,J., Brent,R. and Moore,D.D. TITLE Two classes of proteins dependent on either the presence or absence of thyroid hormone for interaction with the thyroid hormone receptor JOURNAL Mol. Endocrinol. 9 (2), 243-254 (1995) PUBMED 7776974 COMMENT Original source text: Homo sapiens cDNA to mRNA. Trip 13 was isolated as interacting with the thyroid hormone recept or using the yeast 2-hybrid system. Trip13 interacts with the receptor in cel ls grown in the absence of the hormone, but not in cells grown in its presence. The submitted sequence extends from the 2-hybrid fusion junction and does not include the apparent C-terminus of the protein. FEATURES Location/Qualifiers source 1..550 /db_xref="H-InvDB:HIT000193607" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /cell_line="HeLa" gene 1..550 /gene="TRIP13" mRNA <1..>550 /gene="TRIP13" /product="thyroid receptor interactor" CDS <1..>550 /gene="TRIP13" /codon_start=1 /product="thyroid receptor interactor" /protein_id="AAC41732.1" /translation="GGSGRGRGDLKQALPCVAESPTVHVEVHQRGSSTAKKEDINLSV RKLLNRHNIVFGDYTWTEFDEPFLTRNVQSVSIIDTELKVKDSQPIDLSACTVALHIF QLNEDGPSSENLEEETENIIAANHWVLPAAEFHGLWDSLVYDVEVKSHLLDYVMTTLL FSDKNVNSNLITIEGFLQALSLA" BASE COUNT 154 a 125 c 140 g 131 t ORIGIN 1 gggggcagtg gacgaggccg tggcgacctg aagcaggcgc ttccctgtgt ggccgagtcg 61 ccaacggtcc acgtggaggt gcatcagcgc ggcagcagca ctgcaaagaa agaagacata 121 aacctgagtg ttagaaagct actcaacaga cataatattg tgtttggcga ttacacatgg 181 actgagtttg atgaaccttt tttgaccaga aatgtgcagt ctgtgtctat tattgacaca 241 gaattaaagg ttaaagactc acagcccatc gatttgagtg catgcactgt tgcacttcac 301 attttccagc tgaatgaaga tggccccagc agtgaaaatc tggaggaaga gacagaaaac 361 ataattgcag caaatcactg ggttctacct gcagctgaat tccatgggct ttgggacagc 421 ttggtatacg atgtggaagt caaatcccat ctcctcgatt atgtgatgac aactttactg 481 ttttcagaca agaacgtcaa cagcaacctc atcaccatag aggggttcct ccaggccctg 541 tctctggcag //