LOCUS HUMTRIP5M 150 bp mRNA linear HUM 15-MAR-1995 DEFINITION Homo sapiens thyroid receptor interactor (TRIP5) mRNA, partial cds. ACCESSION L40372 VERSION L40372.1 KEYWORDS TRIP5 gene; thyroid receptor interactor. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 150) AUTHORS Lee,J.W., Choi,H.S., Gyuris,J., Brent,R. and Moore,D.D. TITLE Two classes of proteins dependent on either the presence or absence of thyroid hormone for interaction with the thyroid hormone receptor JOURNAL Mol. Endocrinol. 9 (2), 243-254 (1995) PUBMED 7776974 COMMENT Original source text: Homo sapiens cDNA to mRNA. Trip 5 was isolated as interacting with the thyroid hormone receptor using the yeast 2-hybrid system. Interaction is dependent on the presence of thyroid hormone. Submitted sequence consists of a fragment of the apparent protein coding region extending from the 2-hybrid fusion junction. FEATURES Location/Qualifiers source 1..150 /db_xref="H-InvDB:HIT000193600" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" gene 1..150 /gene="TRIP5" mRNA <1..>150 /gene="TRIP5" CDS <1..>150 /gene="TRIP5" /codon_start=1 /product="thyroid receptor interactor" /protein_id="AAC41739.1" /translation="RCESLNTRTVYFSEQWVSSLNEREQELHNLLEVVSQCCEASSSD ITEKSD" BASE COUNT 50 a 24 c 33 g 43 t ORIGIN 1 agatgtgaat ctctgaacac aagaacagtt tatttttctg aacagtgggt atcttcctta 61 aatgaaaggg aacaggaact tcacaactta ttggaggttg taagccaatg ttgtgaggct 121 tcaagttcag acatcactga gaaatcagat //