LOCUS       HUMTRIP5M                150 bp    mRNA    linear   HUM 15-MAR-1995
DEFINITION  Homo sapiens thyroid receptor interactor (TRIP5) mRNA, partial cds.
ACCESSION   L40372
VERSION     L40372.1
KEYWORDS    TRIP5 gene; thyroid receptor interactor.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 150)
  AUTHORS   Lee,J.W., Choi,H.S., Gyuris,J., Brent,R. and Moore,D.D.
  TITLE     Two classes of proteins dependent on either the presence or absence
            of thyroid hormone for interaction with the thyroid hormone
            receptor
  JOURNAL   Mol. Endocrinol. 9 (2), 243-254 (1995)
   PUBMED   7776974
COMMENT     Original source text: Homo sapiens cDNA to mRNA.
            Trip 5 was isolated as interacting with the thyroid hormone
            receptor
            using the yeast 2-hybrid system.  Interaction is dependent on the
            presence of thyroid hormone.  Submitted sequence consists of a
            fragment of the apparent protein coding region extending from the
            2-hybrid fusion junction.
FEATURES             Location/Qualifiers
     source          1..150
                     /db_xref="H-InvDB:HIT000193600"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
     gene            1..150
                     /gene="TRIP5"
     mRNA            <1..>150
                     /gene="TRIP5"
     CDS             <1..>150
                     /gene="TRIP5"
                     /codon_start=1
                     /product="thyroid receptor interactor"
                     /protein_id="AAC41739.1"
                     /translation="RCESLNTRTVYFSEQWVSSLNEREQELHNLLEVVSQCCEASSSD
                     ITEKSD"
BASE COUNT           50 a           24 c           33 g           43 t
ORIGIN      
        1 agatgtgaat ctctgaacac aagaacagtt tatttttctg aacagtgggt atcttcctta
       61 aatgaaaggg aacaggaact tcacaactta ttggaggttg taagccaatg ttgtgaggct
      121 tcaagttcag acatcactga gaaatcagat
//