LOCUS       HUMTRIP2M                250 bp    mRNA    linear   HUM 15-MAR-1995
DEFINITION  Homo sapiens thyroid receptor interactor (TRIP2) mRNA, partial cds.
ACCESSION   L40366
VERSION     L40366.1
KEYWORDS    TRIP2 gene; thyroid receptor interactor.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 250)
  AUTHORS   Lee,J.W., Choi,H.S., Gyuris,J., Brent,R. and Moore,D.D.
  TITLE     Two classes of proteins dependent on either the presence or absence
            of thyroid hormone for interaction with the thyroid hormone
            receptor
  JOURNAL   Mol. Endocrinol. 9 (2), 243-254 (1995)
   PUBMED   7776974
COMMENT     Original source text: Homo sapiens cDNA to mRNA.
            Trip2 was isolated as interacting with the thyroid hormone receptor
            in
            the yeast two hybrid system.  Interaction is dependent on the
            presence
            of thyroid hormone.  Submitted sequence extends from the two hybrid
            fusion junction.
FEATURES             Location/Qualifiers
     source          1..250
                     /db_xref="H-InvDB:HIT000193598"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /cell_line="Hela"
     gene            1..250
                     /gene="TRIP2"
     mRNA            <1..>250
                     /gene="TRIP2"
                     /product="thyroid receptor interactor"
     CDS             <1..>250
                     /gene="TRIP2"
                     /codon_start=1
                     /product="thyroid receptor interactor"
                     /protein_id="AAC41736.1"
                     /translation="PTPPHHTPPPVSSMAGNTKNHPMLMNLLKDNPAQDFSTLYGSSP
                     LERQNSSFGSPRMEICSGSNKTKKKKSSRLPPEKPKQRE"
BASE COUNT           77 a           81 c           47 g           45 t
ORIGIN      
        1 ccgacccctc ctcatcacac gccgccacct gtctcttcga tggccggcaa caccaagaac
       61 cacccgatgc tcatgaacct tcttaaagat aatcctgccc aggatttctc aaccctttat
      121 ggaagcagcc ctttagaaag gcagaactcc tctttcggct caccccgcat ggaaatatgc
      181 tcggggagca acaagaccaa gaaaaagaag tcatcaagat taccacctga gaaaccaaaa
      241 caacgcgagg
//