LOCUS HUMTRIP2M 250 bp mRNA linear HUM 15-MAR-1995 DEFINITION Homo sapiens thyroid receptor interactor (TRIP2) mRNA, partial cds. ACCESSION L40366 VERSION L40366.1 KEYWORDS TRIP2 gene; thyroid receptor interactor. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 250) AUTHORS Lee,J.W., Choi,H.S., Gyuris,J., Brent,R. and Moore,D.D. TITLE Two classes of proteins dependent on either the presence or absence of thyroid hormone for interaction with the thyroid hormone receptor JOURNAL Mol. Endocrinol. 9 (2), 243-254 (1995) PUBMED 7776974 COMMENT Original source text: Homo sapiens cDNA to mRNA. Trip2 was isolated as interacting with the thyroid hormone receptor in the yeast two hybrid system. Interaction is dependent on the presence of thyroid hormone. Submitted sequence extends from the two hybrid fusion junction. FEATURES Location/Qualifiers source 1..250 /db_xref="H-InvDB:HIT000193598" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /cell_line="Hela" gene 1..250 /gene="TRIP2" mRNA <1..>250 /gene="TRIP2" /product="thyroid receptor interactor" CDS <1..>250 /gene="TRIP2" /codon_start=1 /product="thyroid receptor interactor" /protein_id="AAC41736.1" /translation="PTPPHHTPPPVSSMAGNTKNHPMLMNLLKDNPAQDFSTLYGSSP LERQNSSFGSPRMEICSGSNKTKKKKSSRLPPEKPKQRE" BASE COUNT 77 a 81 c 47 g 45 t ORIGIN 1 ccgacccctc ctcatcacac gccgccacct gtctcttcga tggccggcaa caccaagaac 61 cacccgatgc tcatgaacct tcttaaagat aatcctgccc aggatttctc aaccctttat 121 ggaagcagcc ctttagaaag gcagaactcc tctttcggct caccccgcat ggaaatatgc 181 tcggggagca acaagaccaa gaaaaagaag tcatcaagat taccacctga gaaaccaaaa 241 caacgcgagg //