LOCUS HUMTRIP7M 500 bp mRNA linear HUM 01-AUG-1995 DEFINITION Homo sapiens thyroid receptor interactor (TRIP7) mRNA, 3' end of cds. ACCESSION L40357 VERSION L40357.1 KEYWORDS TRIP7 gene; thyroid receptor interactor. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 500) AUTHORS Lee,J.W., Choi,H.S., Gyuris,J., Brent,R. and Moore,D.D. TITLE Two classes of proteins dependent on either the presence or absence of thyroid hormone for interaction with the thyroid hormone receptor JOURNAL Mol. Endocrinol. 9 (2), 243-254 (1995) PUBMED 7776974 COMMENT On Aug 2, 1995 this sequence version replaced gi:695371. Original source text: Homo sapiens cDNA to mRNA. Trip7 was isolated as interacting with the thryroid hormone receptor in the yeast two hybrid system. Interaction is dependent on the presence of thyroid hormone. The submitted sequence extends from the 2-hybrid fusion junction beyond the apparent C-terminus of the protein. The mRNA is approximately 1.1 kb. Amino acids 22 - end are strongly similar to the chromatin proteins H MG-14 and HMG-17, and may correspond to the expressed Trip7 protein. FEATURES Location/Qualifiers source 1..500 /db_xref="H-InvDB:HIT000193597" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /cell_line="Hela" gene 1..500 /gene="TRIP7" mRNA <1..>500 /gene="TRIP7" /product="thyroid receptor interactor" CDS <1..363 /gene="TRIP7" /codon_start=1 /product="thyroid receptor interactor" /protein_id="AAA73877.1" /translation="CRCSSAVPVRCFTFCFTDIVIMPKRKSPENTEGKDGSKVTKQEP TRRSARLSAKPAPPKPEPKPRKTSAKKEPGAKISRGAKGKKEEKQEAGKEGTAPSENG ETKAEEAQKTESVDNEGE" 3'UTR 364..>500 /gene="TRIP7" BASE COUNT 179 a 91 c 117 g 113 t ORIGIN 1 tgccgctgca gcagcgcagt tccagtccgt tgctttactt tttgcttcac cgacatagtc 61 attatgccga agagaaagtc tccagagaat acagagggca aagatggatc caaagtaact 121 aaacaggagc ccacaagacg gtctgccaga ttgtcagcga aacctgctcc accaaaacct 181 gaacccaaac caagaaaaac atctgctaag aaagaacctg gagcaaagat tagcagaggt 241 gctaaaggga agaaggagga aaagcaggaa gctggaaagg aaggtactgc accatctgaa 301 aatggtgaaa ctaaagctga agaggcacag aaaactgaat ctgtagataa cgagggagaa 361 tgaattgtca tgaaaaattg gggttgattt tatgtatctc ttgggacaac ttttaaaagc 421 tatttttacc aagtattttg taaatgctaa ttttttagga ctctactagt tggcatacga 481 aaatatataa ggatggacat //