LOCUS       HUMTRIP7M                500 bp    mRNA    linear   HUM 01-AUG-1995
DEFINITION  Homo sapiens thyroid receptor interactor (TRIP7) mRNA, 3' end of
            cds.
ACCESSION   L40357
VERSION     L40357.1
KEYWORDS    TRIP7 gene; thyroid receptor interactor.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 500)
  AUTHORS   Lee,J.W., Choi,H.S., Gyuris,J., Brent,R. and Moore,D.D.
  TITLE     Two classes of proteins dependent on either the presence or absence
            of thyroid hormone for interaction with the thyroid hormone
            receptor
  JOURNAL   Mol. Endocrinol. 9 (2), 243-254 (1995)
   PUBMED   7776974
COMMENT     On Aug 2, 1995 this sequence version replaced gi:695371.
            Original source text: Homo sapiens cDNA to mRNA.
            Trip7 was isolated as interacting with the thryroid hormone
            receptor in
            the yeast two hybrid system.  Interaction is dependent on the
            presence
            of thyroid hormone. The submitted sequence extends from the
            2-hybrid
            fusion junction beyond the apparent C-terminus of the protein. The
            mRNA
            is approximately 1.1 kb.  Amino acids 22 - end are strongly similar
            to
            the chromatin proteins H MG-14 and HMG-17, and may correspond to
            the
            expressed Trip7 protein.
FEATURES             Location/Qualifiers
     source          1..500
                     /db_xref="H-InvDB:HIT000193597"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /cell_line="Hela"
     gene            1..500
                     /gene="TRIP7"
     mRNA            <1..>500
                     /gene="TRIP7"
                     /product="thyroid receptor interactor"
     CDS             <1..363
                     /gene="TRIP7"
                     /codon_start=1
                     /product="thyroid receptor interactor"
                     /protein_id="AAA73877.1"
                     /translation="CRCSSAVPVRCFTFCFTDIVIMPKRKSPENTEGKDGSKVTKQEP
                     TRRSARLSAKPAPPKPEPKPRKTSAKKEPGAKISRGAKGKKEEKQEAGKEGTAPSENG
                     ETKAEEAQKTESVDNEGE"
     3'UTR           364..>500
                     /gene="TRIP7"
BASE COUNT          179 a           91 c          117 g          113 t
ORIGIN      
        1 tgccgctgca gcagcgcagt tccagtccgt tgctttactt tttgcttcac cgacatagtc
       61 attatgccga agagaaagtc tccagagaat acagagggca aagatggatc caaagtaact
      121 aaacaggagc ccacaagacg gtctgccaga ttgtcagcga aacctgctcc accaaaacct
      181 gaacccaaac caagaaaaac atctgctaag aaagaacctg gagcaaagat tagcagaggt
      241 gctaaaggga agaaggagga aaagcaggaa gctggaaagg aaggtactgc accatctgaa
      301 aatggtgaaa ctaaagctga agaggcacag aaaactgaat ctgtagataa cgagggagaa
      361 tgaattgtca tgaaaaattg gggttgattt tatgtatctc ttgggacaac ttttaaaagc
      421 tatttttacc aagtattttg taaatgctaa ttttttagga ctctactagt tggcatacga
      481 aaatatataa ggatggacat
//