LOCUS       HUMIGLBH1B               377 bp    mRNA    linear   HUM 23-OCT-1995
DEFINITION  Human Ig L-chain V-J region, 5' end.
ACCESSION   L26400
VERSION     L26400.1
KEYWORDS    V-region; immunoglobulin light chain; joining region.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 377)
  AUTHORS   Harmer,I.J., Loizou,S., Thompson,K.M., So,A.K., Walport,M.J. and
            Mackworth-Young,C.
  TITLE     A human monoclonal antiphospholipid antibody that is representative
            of serum antibodies and is germline encoded
  JOURNAL   Arthritis Rheum. 38 (8), 1068-1076 (1995)
   PUBMED   7639802
COMMENT     Original source text: Homo sapiens Adult cDNA to mRNA.
FEATURES             Location/Qualifiers
     source          1..377
                     /db_xref="H-InvDB:HIT000192667"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /cell_line="BH1"
                     /cell_type="B-cell heterohybridoma"
                     /dev_stage="Adult"
     CDS             1..>377
                     /codon_start=1
                     /product="immunoglobulin light chain V region"
                     /protein_id="AAA79856.1"
                     /translation="MAWIPLFLGVLAYCTGSVAFYELTQPPSVSVSPGQTASITCSGD
                     KLGDKYACWYQQKPGQSPILVIYQDSKRPSGIPERFSGSNSGNTATLTISGTQAIDEA
                     DYYCQAWDSSTAVFGTGTKVTVLG"
     sig_peptide     1..57
     mat_peptide     58..>377
                     /product="immunoglobulin light chain VJ region"
BASE COUNT           83 a          113 c           98 g           83 t
ORIGIN      
        1 atggcatgga tccctctctt cctcggcgtc cttgcttact gcacaggatc cgtggccttc
       61 tatgagctga ctcagccacc ctcagtgtca gtgtccccag gacagacagc cagcatcacc
      121 tgctctggag ataaattagg ggataaatat gcttgctggt atcagcagaa gccaggtcag
      181 tcccctatcc tggtcatcta tcaagatagc aagcggccct cagggatccc tgagcgattc
      241 tctggctcca actctgggaa cacagccact ctgaccatca gcgggaccca ggctatcgat
      301 gaggctgact attactgtca ggcgtgggac agcagcactg cggtcttcgg aactgggacc
      361 aaggtcaccg tcctagg
//