LOCUS HUMIGLBH1B 377 bp mRNA linear HUM 23-OCT-1995 DEFINITION Human Ig L-chain V-J region, 5' end. ACCESSION L26400 VERSION L26400.1 KEYWORDS V-region; immunoglobulin light chain; joining region. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 377) AUTHORS Harmer,I.J., Loizou,S., Thompson,K.M., So,A.K., Walport,M.J. and Mackworth-Young,C. TITLE A human monoclonal antiphospholipid antibody that is representative of serum antibodies and is germline encoded JOURNAL Arthritis Rheum. 38 (8), 1068-1076 (1995) PUBMED 7639802 COMMENT Original source text: Homo sapiens Adult cDNA to mRNA. FEATURES Location/Qualifiers source 1..377 /db_xref="H-InvDB:HIT000192667" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /cell_line="BH1" /cell_type="B-cell heterohybridoma" /dev_stage="Adult" CDS 1..>377 /codon_start=1 /product="immunoglobulin light chain V region" /protein_id="AAA79856.1" /translation="MAWIPLFLGVLAYCTGSVAFYELTQPPSVSVSPGQTASITCSGD KLGDKYACWYQQKPGQSPILVIYQDSKRPSGIPERFSGSNSGNTATLTISGTQAIDEA DYYCQAWDSSTAVFGTGTKVTVLG" sig_peptide 1..57 mat_peptide 58..>377 /product="immunoglobulin light chain VJ region" BASE COUNT 83 a 113 c 98 g 83 t ORIGIN 1 atggcatgga tccctctctt cctcggcgtc cttgcttact gcacaggatc cgtggccttc 61 tatgagctga ctcagccacc ctcagtgtca gtgtccccag gacagacagc cagcatcacc 121 tgctctggag ataaattagg ggataaatat gcttgctggt atcagcagaa gccaggtcag 181 tcccctatcc tggtcatcta tcaagatagc aagcggccct cagggatccc tgagcgattc 241 tctggctcca actctgggaa cacagccact ctgaccatca gcgggaccca ggctatcgat 301 gaggctgact attactgtca ggcgtgggac agcagcactg cggtcttcgg aactgggacc 361 aaggtcaccg tcctagg //