LOCUS HUMIGHV13C 525 bp DNA linear HUM 05-OCT-1995 DEFINITION Human immunoglobulin heavy-chain-2 light-chain-2 VH segment V13C (IGHV) exon 2, 5' end. ACCESSION L25542 VERSION L25542.1 KEYWORDS V-region; heavy chain; immunoglobulin. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 525) AUTHORS Nagaoka,H., Ozawa,K., Matsuda,F., Hayashida,H., Matsumura,R., Haino,M., Shin,E.K., Fukita,Y., Imai,T., Anand,R., Yokoyama,K., Eki,T., Soeda,E. and Honjo,T. TITLE Recent translocation of variable and diversity segments of the human immunoglobulin heavy chain from chromosome 14 to chromosomes 15 and 16 JOURNAL Genomics 22 (1), 189-197 (1994) PUBMED 7959766 FEATURES Location/Qualifiers source 1..525 /organism="Homo sapiens" /mol_type="genomic DNA" /db_xref="taxon:9606" /map="15q11-12" /cell_line="GM1416" CDS join(47..92,177..>483) /codon_start=1 /product="immunoglobulin heavy-chain-2 light-chain-2 VH segment" /protein_id="AAA79020.1" /translation="MGWTWRILFLVVIAAGAQSQVQLMQSGAEVKKPGASVRISCKAS GYTFTSYCMHWVCQAHAQGLEWMGLVCPSDGSTSYAQKFQGRVTITRDTSMGTAYMEL SSLRSEDTAMYYCVR" intron 93..176 /number=1 exon 177..483 /number=2 BASE COUNT 127 a 135 c 151 g 112 t ORIGIN 1 ccacacacgt cctctagaga agcccctgag agcacagctc ctcaccatgg gctggacttg 61 gaggatcctg tttttggtgg tcatagctgc aggtaggata attctcagtc cccaggacta 121 aggtgactgg ggtccagtca aagggggttt tatccactcc tgtgtcctct ccacaggtgc 181 ccagtcccag gtacagctga tgcagtctgg ggctgaggtg aagaagcctg gggcctcagt 241 gaggatctcc tgcaaggctt ctggatacac cttcaccagc tactgtatgc actgggtgtg 301 ccaggcccat gcacaagggc ttgagtggat gggattggtg tgccctagtg atggcagcac 361 aagctatgca cagaagttcc agggcagagt caccataacc agggacacat ccatgggcac 421 agcctacatg gagctaagca gcctgagatc tgaggacacg gccatgtatt actgtgtgag 481 agacacaatg tgaaaaccca catcctgaga gtgtcagaaa ttgca //