LOCUS HUMSEC61B 396 bp mRNA linear HUM 14-JUL-1994 DEFINITION Human Sec61-complex beta-subunit mRNA, complete cds. ACCESSION L25085 VERSION L25085.1 KEYWORDS Sec61-complex beta-subunit. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 396) AUTHORS Hartmann,E., Sommer,T., Prehn,S., Gorlich,D., Jentsch,S. and Rapoport,T.A. TITLE Evolutionary conservation of components of the protein translocation complex JOURNAL Nature 367 (6464), 654-657 (1994) PUBMED 8107851 FEATURES Location/Qualifiers source 1..396 /db_xref="H-InvDB:HIT000192606" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /cell_line="HeLa" CDS 64..354 /function="protein translocation across the er-membrane" /codon_start=1 /product="Sec61-complex beta-subunit" /protein_id="AAA19706.1" /translation="MPGPTPSGTNVGSSGRSPSKAVAARAAGSTVRQRKNASCGTRSA GRTTSAGTGGMWRFYTEDSPGLKVGPVPVLVMSLLFIASVFMLHIWGKYTRS" BASE COUNT 84 a 112 c 108 g 92 t ORIGIN 1 ctttcggggg ctccgtaact ttctatccgt ccgcgtcagc gccttgccac cctcatctcc 61 aatatgcctg gtccgacccc cagtggcact aacgtgggat cctcagggcg ctctcccagc 121 aaagcagtgg ccgcccgggc ggcgggatcc actgtccggc agaggaaaaa tgccagctgt 181 gggacaagga gtgcaggccg cacaacctcg gcaggcaccg gggggatgtg gcgattctac 241 acagaagatt cacctgggct caaagttggc cctgttccag tattggttat gagtcttctg 301 ttcatcgctt ctgtatttat gttgcacatt tggggcaagt acactcgttc gtagattcag 361 ttacatccat ctgtcatcta agaaggagga aaaaac //