LOCUS       HUMSEC61B                396 bp    mRNA    linear   HUM 14-JUL-1994
DEFINITION  Human Sec61-complex beta-subunit mRNA, complete cds.
ACCESSION   L25085
VERSION     L25085.1
KEYWORDS    Sec61-complex beta-subunit.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 396)
  AUTHORS   Hartmann,E., Sommer,T., Prehn,S., Gorlich,D., Jentsch,S. and
            Rapoport,T.A.
  TITLE     Evolutionary conservation of components of the protein
            translocation complex
  JOURNAL   Nature 367 (6464), 654-657 (1994)
   PUBMED   8107851
FEATURES             Location/Qualifiers
     source          1..396
                     /db_xref="H-InvDB:HIT000192606"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /cell_line="HeLa"
     CDS             64..354
                     /function="protein translocation across the er-membrane"
                     /codon_start=1
                     /product="Sec61-complex beta-subunit"
                     /protein_id="AAA19706.1"
                     /translation="MPGPTPSGTNVGSSGRSPSKAVAARAAGSTVRQRKNASCGTRSA
                     GRTTSAGTGGMWRFYTEDSPGLKVGPVPVLVMSLLFIASVFMLHIWGKYTRS"
BASE COUNT           84 a          112 c          108 g           92 t
ORIGIN      
        1 ctttcggggg ctccgtaact ttctatccgt ccgcgtcagc gccttgccac cctcatctcc
       61 aatatgcctg gtccgacccc cagtggcact aacgtgggat cctcagggcg ctctcccagc
      121 aaagcagtgg ccgcccgggc ggcgggatcc actgtccggc agaggaaaaa tgccagctgt
      181 gggacaagga gtgcaggccg cacaacctcg gcaggcaccg gggggatgtg gcgattctac
      241 acagaagatt cacctgggct caaagttggc cctgttccag tattggttat gagtcttctg
      301 ttcatcgctt ctgtatttat gttgcacatt tggggcaagt acactcgttc gtagattcag
      361 ttacatccat ctgtcatcta agaaggagga aaaaac
//