LOCUS       HUMIGHEMB                388 bp    DNA     linear   HUM 13-JUL-1993
DEFINITION  Human Ig germline H-chain gene V7-region, 5' end.
ACCESSION   L10057
VERSION     L10057.1
KEYWORDS    V-region; germline; immunoglobulin heavy chain.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 388)
  AUTHORS   van Dijk,K.W., Mortari,F., Kirkham,P.M., Schroeder,H.W. Jr. and
            Milner,E.C.
  TITLE     The human immunoglobulin VH7 gene family consists of a small,
            polymorphic group of six to eight gene segments dispersed
            throughout the VH locus
  JOURNAL   Eur. J. Immunol. 23 (4), 832-839 (1993)
   PUBMED   8458374
COMMENT     Original source text: Homo sapiens (individual_isolate VMRC donor
            3116) (library: 3116 EMBL3) Male Adult blood DNA.
FEATURES             Location/Qualifiers
     source          1..388
                     /organism="Homo sapiens"
                     /mol_type="genomic DNA"
                     /isolate="VMRC donor 3116"
                     /db_xref="taxon:9606"
                     /map="14q32.33"
                     /sex="male"
                     /cell_type="Leukocyte"
                     /tissue_type="blood"
                     /dev_stage="Adult"
                     /germline
                     /tissue_lib="3116 EMBL3"
     gene            1..388
                     /gene="IGHV@"
     intron          1..82
                     /gene="IGHV@"
                     /standard_name="leader intron"
                     /note="putative"
     CDS             <83..>388
                     /gene="IGHV@"
                     /standard_name="VH7"
                     /note="putative"
                     /codon_start=1
                     /product="immunoglobulin heavy chain"
                     /protein_id="AAA36058.1"
                     /translation="GAHSQVQLVQSGSELKKPGASVKVSCKASGYTFTSYAMNWVRQA
                     PGQGLEWMGWINTNTGNPTYAQGFTGRFVFSLDTSVSTAYLQICSLKAEDTAVYYCAR
                     "
     sig_peptide     <83..94
                     /gene="IGHV@"
                     /note="putative"
     V_region        95..388
                     /gene="IGHV@"
                     /standard_name="VH7"
BASE COUNT           88 a          106 c          109 g           85 t
ORIGIN      
        1 taaggggctc cccagtcact gggctgaggg agaaaccagc acagtcaagt gagacttcat
       61 gcactcccat ctcctctcca caggtgccca ctcccaggtg cagctggtgc aatctgggtc
      121 tgagttgaag aagcctgggg cctcagtgaa ggtttcctgc aaggcttctg gatacacctt
      181 cactagctat gctatgaatt gggtgcgaca ggcccctgga caagggcttg agtggatggg
      241 atggatcaac accaacactg ggaacccaac gtatgcccag ggcttcacag gacggtttgt
      301 cttctccttg gacacctctg tcagcacggc atatctgcag atctgcagcc taaaggctga
      361 ggacactgcc gtgtattact gtgcgaga
//