LOCUS HUMIGHEMB 388 bp DNA linear HUM 13-JUL-1993 DEFINITION Human Ig germline H-chain gene V7-region, 5' end. ACCESSION L10057 VERSION L10057.1 KEYWORDS V-region; germline; immunoglobulin heavy chain. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 388) AUTHORS van Dijk,K.W., Mortari,F., Kirkham,P.M., Schroeder,H.W. Jr. and Milner,E.C. TITLE The human immunoglobulin VH7 gene family consists of a small, polymorphic group of six to eight gene segments dispersed throughout the VH locus JOURNAL Eur. J. Immunol. 23 (4), 832-839 (1993) PUBMED 8458374 COMMENT Original source text: Homo sapiens (individual_isolate VMRC donor 3116) (library: 3116 EMBL3) Male Adult blood DNA. FEATURES Location/Qualifiers source 1..388 /organism="Homo sapiens" /mol_type="genomic DNA" /isolate="VMRC donor 3116" /db_xref="taxon:9606" /map="14q32.33" /sex="male" /cell_type="Leukocyte" /tissue_type="blood" /dev_stage="Adult" /germline /tissue_lib="3116 EMBL3" gene 1..388 /gene="IGHV@" intron 1..82 /gene="IGHV@" /standard_name="leader intron" /note="putative" CDS <83..>388 /gene="IGHV@" /standard_name="VH7" /note="putative" /codon_start=1 /product="immunoglobulin heavy chain" /protein_id="AAA36058.1" /translation="GAHSQVQLVQSGSELKKPGASVKVSCKASGYTFTSYAMNWVRQA PGQGLEWMGWINTNTGNPTYAQGFTGRFVFSLDTSVSTAYLQICSLKAEDTAVYYCAR " sig_peptide <83..94 /gene="IGHV@" /note="putative" V_region 95..388 /gene="IGHV@" /standard_name="VH7" BASE COUNT 88 a 106 c 109 g 85 t ORIGIN 1 taaggggctc cccagtcact gggctgaggg agaaaccagc acagtcaagt gagacttcat 61 gcactcccat ctcctctcca caggtgccca ctcccaggtg cagctggtgc aatctgggtc 121 tgagttgaag aagcctgggg cctcagtgaa ggtttcctgc aaggcttctg gatacacctt 181 cactagctat gctatgaatt gggtgcgaca ggcccctgga caagggcttg agtggatggg 241 atggatcaac accaacactg ggaacccaac gtatgcccag ggcttcacag gacggtttgt 301 cttctccttg gacacctctg tcagcacggc atatctgcag atctgcagcc taaaggctga 361 ggacactgcc gtgtattact gtgcgaga //