LOCUS HUMCGRP 216 bp mRNA linear HUM 01-NOV-1994 DEFINITION Human calcitonin gene related peptide mRNA, partial cds. ACCESSION K03512 VERSION K03512.1 KEYWORDS alternative splicing; calcitonin gene-related peptide. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 216) AUTHORS Nelkin,B.D., Rosenfeld,K.I., de Bustros,A., Leong,S.S., Roos,B.A. and Baylin,S.B. TITLE Structure and expression of a gene encoding human calcitonin and calcitonin gene related peptide JOURNAL Biochem. Biophys. Res. Commun. 123 (2), 648-655 (1984) PUBMED 6148938 COMMENT Original source text: Human medullary thyroid carcinoma cell line TT, cDNA to mRNA, clone pTT42. Clean copy sequence for [1] kindly provided by B.D.Nelkin, 23-MAY-1985. The calcitonin gene related peptide and calcitonin are encoded by the same gene. They are transcribed by alternative splicing. FEATURES Location/Qualifiers source 1..216 /db_xref="H-InvDB:HIT000191429" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /map="11p15.2-p15.1" gene 1..216 /gene="CALCA" CDS <1..>216 /gene="CALCA" /note="calcitonin gene related protein" /codon_start=1 /protein_id="AAA52011.1" /db_xref="GDB:G00-120-571" /translation="RLLLAALVQDYVQMKASELEQEQEREGSRIIAQKRACDTATCVT HRLAGLLSRSGGVVKNNFVPTNVGSKAF" BASE COUNT 50 a 52 c 70 g 44 t ORIGIN Chromosome 11p15.4. 1 cgcctcctgc tggctgcact ggtccaggac tatgtgcaga tgaaggccag tgagctggag 61 caggagcaag agagagaggg ctccagaatc attgcccaga agagagcctg tgacactgcc 121 acttgtgtga ctcatcggct ggcaggcttg ctgagcagat cagggggtgt ggtgaagaac 181 aactttgtgc ccaccaatgt gggttccaaa gccttt //