LOCUS       HUMNPY                   551 bp    mRNA    linear   HUM 07-JAN-1995
DEFINITION  Human neuropeptide Y (NPY) mRNA, complete cds.
ACCESSION   K01911
VERSION     K01911.1
KEYWORDS    neuropeptide Y.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 551)
  AUTHORS   Minth,C.D., Bloom,S.R., Polak,J.M. and Dixon,J.E.
  TITLE     Cloning, characterization, and DNA sequence of a human cDNA
            encoding neuropeptide tyrosine
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 81 (14), 4577-4581 (1984)
   PUBMED   6589611
COMMENT     Original source text: Human pheochromocytoma, cDNA to mRNA, clone
            pNPY3-75.
            Neuropeptide Y (NPY) is one of the most abundant peptides in the
            mammalian nervous system, and its extensive distribution suggests a
            neuro-transmitter or -modulator role. NPY is also found in some
            chromaffin cells of the adrenal medulla.
FEATURES             Location/Qualifiers
     source          1..551
                     /db_xref="H-InvDB:HIT000191373"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /map="7pter-q22"
                     /tissue_type="pheochromocytoma"
     gene            1..551
                     /gene="NPY"
     mRNA            <1..551
                     /gene="NPY"
                     /note="G00-119-456"
     CDS             87..380
                     /gene="NPY"
                     /codon_start=1
                     /product="neuropeptide Y"
                     /protein_id="AAA59944.1"
                     /db_xref="GDB:G00-119-456"
                     /translation="MLGNKRLGLSGLTLALSLLVCLGALAEAYPSKPDNPGEDAPAED
                     MARYYSALRHYINLITRQRYGKRSSPETLISDLLMRESTENVPRTRLEDPAMW"
     sig_peptide     87..170
                     /gene="NPY"
                     /note="G00-119-456"
     mat_peptide     171..278
                     /gene="NPY"
                     /product="neuropeptide Y"
                     /note="G00-119-456"
BASE COUNT          131 a          171 c          129 g          120 t
ORIGIN      51 bp upstream of RsaI site.
        1 accccatccg ctggctctca cccctcggag acgctcgccc gacagcatag tacttgccgc
       61 ccagccacgc ccgcgcgcca gccaccatgc taggtaacaa gcgactgggg ctgtccggac
      121 tgaccctcgc cctgtccctg ctcgtgtgcc tgggtgcgct ggccgaggcg tacccctcca
      181 agccggacaa cccgggcgag gacgcaccag cggaggacat ggccagatac tactcggcgc
      241 tgcgacacta catcaacctc atcaccaggc agagatatgg aaaacgatcc agcccagaga
      301 cactgatttc agacctcttg atgagagaaa gcacagaaaa tgttcccaga actcggcttg
      361 aagaccctgc aatgtggtga tgggaaatga gacttgctct ctggcctttt cctattttca
      421 gcccatattt catcgtgtaa aacgagaatc cacccatcct accaatgcat gcagccactg
      481 tgctgaattc tgcaatgttt tcctttgtca tcattgtata tatgtgtgtt taaataaagt
      541 atcatgcatt c
//