LOCUS HUMNPY 551 bp mRNA linear HUM 07-JAN-1995 DEFINITION Human neuropeptide Y (NPY) mRNA, complete cds. ACCESSION K01911 VERSION K01911.1 KEYWORDS neuropeptide Y. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 551) AUTHORS Minth,C.D., Bloom,S.R., Polak,J.M. and Dixon,J.E. TITLE Cloning, characterization, and DNA sequence of a human cDNA encoding neuropeptide tyrosine JOURNAL Proc. Natl. Acad. Sci. U.S.A. 81 (14), 4577-4581 (1984) PUBMED 6589611 COMMENT Original source text: Human pheochromocytoma, cDNA to mRNA, clone pNPY3-75. Neuropeptide Y (NPY) is one of the most abundant peptides in the mammalian nervous system, and its extensive distribution suggests a neuro-transmitter or -modulator role. NPY is also found in some chromaffin cells of the adrenal medulla. FEATURES Location/Qualifiers source 1..551 /db_xref="H-InvDB:HIT000191373" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /map="7pter-q22" /tissue_type="pheochromocytoma" gene 1..551 /gene="NPY" mRNA <1..551 /gene="NPY" /note="G00-119-456" CDS 87..380 /gene="NPY" /codon_start=1 /product="neuropeptide Y" /protein_id="AAA59944.1" /db_xref="GDB:G00-119-456" /translation="MLGNKRLGLSGLTLALSLLVCLGALAEAYPSKPDNPGEDAPAED MARYYSALRHYINLITRQRYGKRSSPETLISDLLMRESTENVPRTRLEDPAMW" sig_peptide 87..170 /gene="NPY" /note="G00-119-456" mat_peptide 171..278 /gene="NPY" /product="neuropeptide Y" /note="G00-119-456" BASE COUNT 131 a 171 c 129 g 120 t ORIGIN 51 bp upstream of RsaI site. 1 accccatccg ctggctctca cccctcggag acgctcgccc gacagcatag tacttgccgc 61 ccagccacgc ccgcgcgcca gccaccatgc taggtaacaa gcgactgggg ctgtccggac 121 tgaccctcgc cctgtccctg ctcgtgtgcc tgggtgcgct ggccgaggcg tacccctcca 181 agccggacaa cccgggcgag gacgcaccag cggaggacat ggccagatac tactcggcgc 241 tgcgacacta catcaacctc atcaccaggc agagatatgg aaaacgatcc agcccagaga 301 cactgatttc agacctcttg atgagagaaa gcacagaaaa tgttcccaga actcggcttg 361 aagaccctgc aatgtggtga tgggaaatga gacttgctct ctggcctttt cctattttca 421 gcccatattt catcgtgtaa aacgagaatc cacccatcct accaatgcat gcagccactg 481 tgctgaattc tgcaatgttt tcctttgtca tcattgtata tatgtgtgtt taaataaagt 541 atcatgcatt c //