LOCUS       HUMHPA1B                1234 bp    mRNA    linear   HUM 08-NOV-1994
DEFINITION  Human haptoglobin alpha(1S)-beta precursor, mRNA.
ACCESSION   K01763
VERSION     K01763.1
KEYWORDS    glycoprotein; haptoglobin.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1234)
  AUTHORS   van der Straten,A., Herzog,A., Cabezon,T. and Bollen,A.
  TITLE     Characterization of human haptoglobin cDNAs coding for alpha 2FS
            beta and alpha 1S beta variants
  JOURNAL   FEBS Lett. 168 (1), 103-107 (1984)
   PUBMED   6546723
COMMENT     Original source text: Human (heterozygous Hp2-1) liver, cDNA to
            mRNA, clone pULB5741.
            Data kindly reviewed (23-MAY-1984) by A. van der Straten. Hp mRNA
            codes for both alpha and beta polypeptides in tandem. The two
            chains are linked on the alpha-beta precursor by a single Arg
            residue (507-509), which is released during the proteolytic
            maturation generating the alpha and beta subunits. This cleavage
            mechanism gives further support to the hypothesis of a common
            ancestor for Hp and the serine protease family. There are two
            electrophoretic types of Hp-alpha-1 chains, alpha-1F (fast) and
            alpha-1S (slow), differing by a Lys/Glu amino acid sustitution at
            position 53. Two alleles control their structure, Hp-alpha(1S) and
            Hp-alpha(1F). The third allele Hp-alpha-2 is the product of a
            partial gene duplication possibly resulting from an unequal
            crossover event in a heterozygous genotype Hp-alpha-1F/Hp-alpha-1S.
            An Hp-alpha(2FS)-beta variant was also presented in [1]; the DNA
            sequences are identical except for the Ala 11 to Glu 69 duplicated
            portion of alpha-2.
FEATURES             Location/Qualifiers
     source          1..1234
                     /db_xref="H-InvDB:HIT000191370"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /map="16q22.1"
     gene            1..1234
                     /gene="HP"
     mRNA            <1..1234
                     /gene="HP"
                     /product="Hp mRNA"
     CDS             27..1070
                     /gene="HP"
                     /note="preprohaptoglobin"
                     /codon_start=1
                     /protein_id="AAA52684.1"
                     /db_xref="GDB:G00-119-314"
                     /translation="MSALGAVIALLLWGQLFAVDSGNDVTDIADDGCPKPPEIAHGYV
                     EHSVRYQCKNYYKLRTEGDGVYTLNNEKQWINKAVGDKLPECEAVCGKPKNPANPVQR
                     ILGGHLDAKGSFPWQAKMVSHHNLTTGATLINEQWLLTTAKNLFLNHSENATAKDIAP
                     TLTLYVGKKQLVEIEKVVLHPNYSQVDIGLIKLKQKVSVNERVMPICLPSKDYAEVGR
                     VGYVSGWGRNANFKFTDHLKYVMLPVADQDQCIRHYEGSTVPEKKTPKSPVGVQPILN
                     EHTFCAGMSKYQEDTCYGDAGSAFAVHDLEEDTWYATGILSFDKSCAVAEYGVYVKVT
                     SIQDWVQKTIAEN"
     sig_peptide     27..80
                     /gene="HP"
                     /note="preprohaptoglobin signal peptide"
     mat_peptide     81..329
                     /gene="HP"
                     /product="haptoglobin alpha-1S chain, mature peptide"
     mat_peptide     333..1067
                     /gene="HP"
                     /product="haptoglobin beta chain, mature peptide"
BASE COUNT          340 a          282 c          337 g          275 t
ORIGIN      135 bp upstream of AvaI site.
        1 ctcttccaga ggcaagacca accaagatga gtgccttggg agctgtcatt gccctcctgc
       61 tctggggaca gctttttgca gtggactcag gcaatgatgt cacggatatc gcagatgacg
      121 gctgcccgaa gccccccgag attgcacatg gctatgtgga gcactcggtt cgctaccagt
      181 gtaagaacta ctacaaactg cgcacagaag gagatggagt gtacacctta aacaatgaga
      241 agcagtggat aaataaggct gttggagata aacttcctga atgtgaagca gtatgtggga
      301 agcccaagaa tccggcaaac ccagtgcagc ggatcctggg tggacacctg gatgccaaag
      361 gcagctttcc ctggcaggct aagatggttt cccaccataa tctcaccaca ggtgccacgc
      421 tgatcaatga acaatggctg ctgaccacgg ctaaaaatct cttcctgaac cattcagaaa
      481 atgcaacagc gaaagacatt gcccccactt taacactcta tgtggggaaa aagcagcttg
      541 tagagattga gaaggttgtt ctacacccta actactccca agtagatatt gggctcatca
      601 aactcaaaca gaaggtgtct gttaatgaga gagtgatgcc catctgccta ccatccaagg
      661 attatgcaga agtagggcgt gtgggttatg tttctggctg ggggcgaaat gccaatttta
      721 aatttactga ccatctgaag tatgtcatgc tgcctgtggc tgaccaagac caatgcataa
      781 ggcattatga aggcagcaca gtccccgaaa agaagacacc gaagagccct gtaggggtgc
      841 agcccatact gaatgaacac accttctgtg ctggcatgtc taagtaccaa gaagacacct
      901 gctatggcga tgcgggcagt gcctttgccg ttcacgacct ggaggaggac acctggtatg
      961 cgactgggat cttaagcttt gataagagct gtgctgtggc tgagtatggt gtgtatgtga
     1021 aggtgacttc catccaggac tgggttcaga agaccatagc tgagaactaa tgcaaggctg
     1081 gccggaagcc cttgcctgaa agcaagattt cagcctggaa gagggcaaag tggacgggag
     1141 tggacaggag tggatgcgat aagatgtggt ttgaagctga tgggtgccag ccctgcattg
     1201 ctgagtcaat caataaagag ctttcttttg accc
//