LOCUS HUMHPA1B 1234 bp mRNA linear HUM 08-NOV-1994 DEFINITION Human haptoglobin alpha(1S)-beta precursor, mRNA. ACCESSION K01763 VERSION K01763.1 KEYWORDS glycoprotein; haptoglobin. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 1234) AUTHORS van der Straten,A., Herzog,A., Cabezon,T. and Bollen,A. TITLE Characterization of human haptoglobin cDNAs coding for alpha 2FS beta and alpha 1S beta variants JOURNAL FEBS Lett. 168 (1), 103-107 (1984) PUBMED 6546723 COMMENT Original source text: Human (heterozygous Hp2-1) liver, cDNA to mRNA, clone pULB5741. Data kindly reviewed (23-MAY-1984) by A. van der Straten. Hp mRNA codes for both alpha and beta polypeptides in tandem. The two chains are linked on the alpha-beta precursor by a single Arg residue (507-509), which is released during the proteolytic maturation generating the alpha and beta subunits. This cleavage mechanism gives further support to the hypothesis of a common ancestor for Hp and the serine protease family. There are two electrophoretic types of Hp-alpha-1 chains, alpha-1F (fast) and alpha-1S (slow), differing by a Lys/Glu amino acid sustitution at position 53. Two alleles control their structure, Hp-alpha(1S) and Hp-alpha(1F). The third allele Hp-alpha-2 is the product of a partial gene duplication possibly resulting from an unequal crossover event in a heterozygous genotype Hp-alpha-1F/Hp-alpha-1S. An Hp-alpha(2FS)-beta variant was also presented in [1]; the DNA sequences are identical except for the Ala 11 to Glu 69 duplicated portion of alpha-2. FEATURES Location/Qualifiers source 1..1234 /db_xref="H-InvDB:HIT000191370" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /map="16q22.1" gene 1..1234 /gene="HP" mRNA <1..1234 /gene="HP" /product="Hp mRNA" CDS 27..1070 /gene="HP" /note="preprohaptoglobin" /codon_start=1 /protein_id="AAA52684.1" /db_xref="GDB:G00-119-314" /translation="MSALGAVIALLLWGQLFAVDSGNDVTDIADDGCPKPPEIAHGYV EHSVRYQCKNYYKLRTEGDGVYTLNNEKQWINKAVGDKLPECEAVCGKPKNPANPVQR ILGGHLDAKGSFPWQAKMVSHHNLTTGATLINEQWLLTTAKNLFLNHSENATAKDIAP TLTLYVGKKQLVEIEKVVLHPNYSQVDIGLIKLKQKVSVNERVMPICLPSKDYAEVGR VGYVSGWGRNANFKFTDHLKYVMLPVADQDQCIRHYEGSTVPEKKTPKSPVGVQPILN EHTFCAGMSKYQEDTCYGDAGSAFAVHDLEEDTWYATGILSFDKSCAVAEYGVYVKVT SIQDWVQKTIAEN" sig_peptide 27..80 /gene="HP" /note="preprohaptoglobin signal peptide" mat_peptide 81..329 /gene="HP" /product="haptoglobin alpha-1S chain, mature peptide" mat_peptide 333..1067 /gene="HP" /product="haptoglobin beta chain, mature peptide" BASE COUNT 340 a 282 c 337 g 275 t ORIGIN 135 bp upstream of AvaI site. 1 ctcttccaga ggcaagacca accaagatga gtgccttggg agctgtcatt gccctcctgc 61 tctggggaca gctttttgca gtggactcag gcaatgatgt cacggatatc gcagatgacg 121 gctgcccgaa gccccccgag attgcacatg gctatgtgga gcactcggtt cgctaccagt 181 gtaagaacta ctacaaactg cgcacagaag gagatggagt gtacacctta aacaatgaga 241 agcagtggat aaataaggct gttggagata aacttcctga atgtgaagca gtatgtggga 301 agcccaagaa tccggcaaac ccagtgcagc ggatcctggg tggacacctg gatgccaaag 361 gcagctttcc ctggcaggct aagatggttt cccaccataa tctcaccaca ggtgccacgc 421 tgatcaatga acaatggctg ctgaccacgg ctaaaaatct cttcctgaac cattcagaaa 481 atgcaacagc gaaagacatt gcccccactt taacactcta tgtggggaaa aagcagcttg 541 tagagattga gaaggttgtt ctacacccta actactccca agtagatatt gggctcatca 601 aactcaaaca gaaggtgtct gttaatgaga gagtgatgcc catctgccta ccatccaagg 661 attatgcaga agtagggcgt gtgggttatg tttctggctg ggggcgaaat gccaatttta 721 aatttactga ccatctgaag tatgtcatgc tgcctgtggc tgaccaagac caatgcataa 781 ggcattatga aggcagcaca gtccccgaaa agaagacacc gaagagccct gtaggggtgc 841 agcccatact gaatgaacac accttctgtg ctggcatgtc taagtaccaa gaagacacct 901 gctatggcga tgcgggcagt gcctttgccg ttcacgacct ggaggaggac acctggtatg 961 cgactgggat cttaagcttt gataagagct gtgctgtggc tgagtatggt gtgtatgtga 1021 aggtgacttc catccaggac tgggttcaga agaccatagc tgagaactaa tgcaaggctg 1081 gccggaagcc cttgcctgaa agcaagattt cagcctggaa gagggcaaag tggacgggag 1141 tggacaggag tggatgcgat aagatgtggt ttgaagctga tgggtgccag ccctgcattg 1201 ctgagtcaat caataaagag ctttcttttg accc //