LOCUS       JF308524                 593 bp    mRNA    linear   HUM 14-APR-2014
DEFINITION  Homo sapiens CNK3/IPCEF1 fusion protein short isoform mRNA, partial
            cds.
ACCESSION   JF308524
VERSION     JF308524.1
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 593)
  AUTHORS   Attar,M.A., Salem,J.C., Pursel,H.S. and Santy,L.C.
  TITLE     CNK3 and IPCEF1 produce a single protein that is required for HGF
            dependent Arf6 activation and migration
  JOURNAL   Exp. Cell Res. 318 (3), 228-237 (2012)
   PUBMED   22085542
REFERENCE   2  (bases 1 to 593)
  AUTHORS   Santy,L.C.
  TITLE     Direct Submission
  JOURNAL   Submitted (07-FEB-2011) Biochemistry and Molecular Biology,
            Pennsylvania State University, 101 S. Frear, University Park, PA
            16802, USA
FEATURES             Location/Qualifiers
     source          1..593
                     /db_xref="H-InvDB:HIT000715332"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /cell_line="CaCo-2"
                     /PCR_primers="fwd_seq: aacaccatcttatggcaagc, rev_seq:
                     tgttaactgtgtcaggcaagg"
     CDS             <1..>593
                     /note="spliced product produced from neighboring CNK3 and
                     IPCEF1 genes"
                     /codon_start=2
                     /product="CNK3/IPCEF1 fusion protein short isoform"
                     /protein_id="AEA29621.1"
                     /translation="TPSYGKPRPLSMPADGNWMGIVDPFARPRGHGRKAFVSTKMTSY
                     MAIDGSALAEKADGFVNLPDFTVERASECKKKHAFKISHPQIKTFYFAAENVQEMNVW
                     LNKLGSAVIHQESTTKDEECYSESEQEDPEIAAETPPPPHASQTQSLTAQQASLSSPS
                     LSGTSYSFSSLENTVKTPSSFPSSLSKERQSLPDTVN"
BASE COUNT          170 a          141 c          131 g          151 t
ORIGIN      
        1 aacaccatct tatggcaagc cacggccttt gtccatgcct gctgatggga actggatggg
       61 gattgtggac ccttttgcca gacctcgagg tcatggcagg aaagcttttg tttctactaa
      121 gatgacatca tacatggcta ttgatggcag tgctcttgca gagaaagctg atggatttgt
      181 caacctgcct gatttcactg tggaaagagc atcagaatgc aagaaaaagc atgcttttaa
      241 gatcagccat ccacagatca agacctttta ttttgcagct gagaatgtgc aggaaatgaa
      301 cgtgtggtta aataaacttg gatcggctgt aatccatcag gaatccacta caaaggatga
      361 agaatgttac agtgaaagtg aacaggaaga tccagaaata gctgcggaga caccaccccc
      421 tcctcacgct tcccagactc agtctttgac tgcacagcag gcatctttat cctcacccag
      481 cctgagtgga acgtcgtatt ctttctcttc cctggaaaat acagtgaaga cacccagcag
      541 ttttccttcc tccttatcta aagagagaca atccttgcct gacacagtta aca
//