LOCUS JF308524 593 bp mRNA linear HUM 14-APR-2014 DEFINITION Homo sapiens CNK3/IPCEF1 fusion protein short isoform mRNA, partial cds. ACCESSION JF308524 VERSION JF308524.1 KEYWORDS . SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 593) AUTHORS Attar,M.A., Salem,J.C., Pursel,H.S. and Santy,L.C. TITLE CNK3 and IPCEF1 produce a single protein that is required for HGF dependent Arf6 activation and migration JOURNAL Exp. Cell Res. 318 (3), 228-237 (2012) PUBMED 22085542 REFERENCE 2 (bases 1 to 593) AUTHORS Santy,L.C. TITLE Direct Submission JOURNAL Submitted (07-FEB-2011) Biochemistry and Molecular Biology, Pennsylvania State University, 101 S. Frear, University Park, PA 16802, USA FEATURES Location/Qualifiers source 1..593 /db_xref="H-InvDB:HIT000715332" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /cell_line="CaCo-2" /PCR_primers="fwd_seq: aacaccatcttatggcaagc, rev_seq: tgttaactgtgtcaggcaagg" CDS <1..>593 /note="spliced product produced from neighboring CNK3 and IPCEF1 genes" /codon_start=2 /product="CNK3/IPCEF1 fusion protein short isoform" /protein_id="AEA29621.1" /translation="TPSYGKPRPLSMPADGNWMGIVDPFARPRGHGRKAFVSTKMTSY MAIDGSALAEKADGFVNLPDFTVERASECKKKHAFKISHPQIKTFYFAAENVQEMNVW LNKLGSAVIHQESTTKDEECYSESEQEDPEIAAETPPPPHASQTQSLTAQQASLSSPS LSGTSYSFSSLENTVKTPSSFPSSLSKERQSLPDTVN" BASE COUNT 170 a 141 c 131 g 151 t ORIGIN 1 aacaccatct tatggcaagc cacggccttt gtccatgcct gctgatggga actggatggg 61 gattgtggac ccttttgcca gacctcgagg tcatggcagg aaagcttttg tttctactaa 121 gatgacatca tacatggcta ttgatggcag tgctcttgca gagaaagctg atggatttgt 181 caacctgcct gatttcactg tggaaagagc atcagaatgc aagaaaaagc atgcttttaa 241 gatcagccat ccacagatca agacctttta ttttgcagct gagaatgtgc aggaaatgaa 301 cgtgtggtta aataaacttg gatcggctgt aatccatcag gaatccacta caaaggatga 361 agaatgttac agtgaaagtg aacaggaaga tccagaaata gctgcggaga caccaccccc 421 tcctcacgct tcccagactc agtctttgac tgcacagcag gcatctttat cctcacccag 481 cctgagtgga acgtcgtatt ctttctcttc cctggaaaat acagtgaaga cacccagcag 541 ttttccttcc tccttatcta aagagagaca atccttgcct gacacagtta aca //