LOCUS HUMPROLEU 659 bp mRNA linear HUM 08-JAN-1995 DEFINITION Human secretory granule proteoglycan peptide core mRNA, complete cds. ACCESSION J03223 VERSION J03223.1 KEYWORDS secretory granule proteoglycan peptide core. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 659) AUTHORS Stevens,R.L., Avraham,S., Gartner,M.C., Bruns,G.A., Austen,K.F. and Weis,J.H. TITLE Isolation and characterization of a cDNA that encodes the peptide core of the secretory granule proteoglycan of human promyelocytic leukemia HL-60 cells JOURNAL J. Biol. Chem. 263 (15), 7287-7291 (1988) PUBMED 2835370 COMMENT Original source text: Human promyelocytic leukemia cell line HL-60 cells, cDNA to mRNA. Draft entry and computer-readable sequence for [1] kindly submitted by R.L.Stevens, 14-SEP-1988. FEATURES Location/Qualifiers source 1..659 /db_xref="H-InvDB:HIT000191141" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /map="10q22.1" gene 1..659 /gene="PRG1" CDS 32..508 /gene="PRG1" /note="secretory granule proteoglycan peptide core" /codon_start=1 /protein_id="AAA60179.1" /db_xref="GDB:G00-120-312" /translation="MMQKLLKCSRLVLALALILVLESSVQGYPTQRARYQWVRCNPDS NSANCLEEKGPMFELLPGESNKIPRLRTDLFPKTRIQDLNRIFPLSEDYSGSGFGSGS GSGSGSGSGFLTEMEQDYQLVDESDAFHDNLRSLDRNLPSDSQDLGQHGLEEDFML" sig_peptide 32..112 /gene="PRG1" /note="secretory granule proteoglycan signal peptide" mat_peptide 113..505 /gene="PRG1" /product="secretory granule proteoglycan peptide core" BASE COUNT 183 a 145 c 147 g 184 t ORIGIN 207 bp upstream of XmnI site; Chromosome 10. 1 gtgcagctgg gagagctaga ctaagttggt catgatgcag aagctactca aatgcagtcg 61 gcttgtcctg gctcttgccc tcatcctggt tctggaatcc tcagttcaag gttatcctac 121 gcagagagcc aggtaccaat gggtgcgctg caatccagac agtaattctg caaactgcct 181 tgaagaaaaa ggaccaatgt tcgaactact tccaggtgaa tccaacaaga tcccccgtct 241 gaggactgac ctttttccaa agacgagaat ccaggacttg aatcgtatct tcccactttc 301 tgaggactac tctggatcag gcttcggctc cggctccggc tctggatcag gatctgggag 361 tggcttccta acggaaatgg aacaggatta ccaactagta gacgaaagtg atgctttcca 421 tgacaacctt aggtctcttg acaggaatct gccctcagac agccaggact tgggtcaaca 481 tggattagaa gaggatttta tgttataaaa gaggattttc ccaccttgac accaggcaat 541 gtagttagca tattttatgt accatggtta tatgattaat cttgggacaa agaattttat 601 agaaattttt aaacatctga aaaagaagct taagttttat catccttttt ttttctcat //