LOCUS       HUMPROLEU                659 bp    mRNA    linear   HUM 08-JAN-1995
DEFINITION  Human secretory granule proteoglycan peptide core mRNA, complete
            cds.
ACCESSION   J03223
VERSION     J03223.1
KEYWORDS    secretory granule proteoglycan peptide core.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 659)
  AUTHORS   Stevens,R.L., Avraham,S., Gartner,M.C., Bruns,G.A., Austen,K.F. and
            Weis,J.H.
  TITLE     Isolation and characterization of a cDNA that encodes the peptide
            core of the secretory granule proteoglycan of human promyelocytic
            leukemia HL-60 cells
  JOURNAL   J. Biol. Chem. 263 (15), 7287-7291 (1988)
   PUBMED   2835370
COMMENT     Original source text: Human promyelocytic leukemia cell line HL-60
            cells, cDNA to mRNA.
            Draft entry and computer-readable sequence for [1] kindly submitted
            by R.L.Stevens, 14-SEP-1988.
FEATURES             Location/Qualifiers
     source          1..659
                     /db_xref="H-InvDB:HIT000191141"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /map="10q22.1"
     gene            1..659
                     /gene="PRG1"
     CDS             32..508
                     /gene="PRG1"
                     /note="secretory granule proteoglycan peptide core"
                     /codon_start=1
                     /protein_id="AAA60179.1"
                     /db_xref="GDB:G00-120-312"
                     /translation="MMQKLLKCSRLVLALALILVLESSVQGYPTQRARYQWVRCNPDS
                     NSANCLEEKGPMFELLPGESNKIPRLRTDLFPKTRIQDLNRIFPLSEDYSGSGFGSGS
                     GSGSGSGSGFLTEMEQDYQLVDESDAFHDNLRSLDRNLPSDSQDLGQHGLEEDFML"
     sig_peptide     32..112
                     /gene="PRG1"
                     /note="secretory granule proteoglycan signal peptide"
     mat_peptide     113..505
                     /gene="PRG1"
                     /product="secretory granule proteoglycan peptide core"
BASE COUNT          183 a          145 c          147 g          184 t
ORIGIN      207 bp upstream of XmnI site; Chromosome 10.
        1 gtgcagctgg gagagctaga ctaagttggt catgatgcag aagctactca aatgcagtcg
       61 gcttgtcctg gctcttgccc tcatcctggt tctggaatcc tcagttcaag gttatcctac
      121 gcagagagcc aggtaccaat gggtgcgctg caatccagac agtaattctg caaactgcct
      181 tgaagaaaaa ggaccaatgt tcgaactact tccaggtgaa tccaacaaga tcccccgtct
      241 gaggactgac ctttttccaa agacgagaat ccaggacttg aatcgtatct tcccactttc
      301 tgaggactac tctggatcag gcttcggctc cggctccggc tctggatcag gatctgggag
      361 tggcttccta acggaaatgg aacaggatta ccaactagta gacgaaagtg atgctttcca
      421 tgacaacctt aggtctcttg acaggaatct gccctcagac agccaggact tgggtcaaca
      481 tggattagaa gaggatttta tgttataaaa gaggattttc ccaccttgac accaggcaat
      541 gtagttagca tattttatgt accatggtta tatgattaat cttgggacaa agaattttat
      601 agaaattttt aaacatctga aaaagaagct taagttttat catccttttt ttttctcat
//