LOCUS HUMPLB 792 bp mRNA linear HUM 29-APR-1996
DEFINITION Human placental lactogen hormone (PL-4) mRNA, complete cds.
ACCESSION J00118
VERSION J00118.1
KEYWORDS lactogen; somatomammotropin.
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 507 to 730)
AUTHORS Seeburg,P.H., Shine,J., Martial,J.A., Ullrich,A., Baxter,J.D. and
Goodman,H.M.
TITLE Nucleotide sequence of part of the gene for human chorionic
somatomammotropin: purification of DNA complementary to predominant
mRNA species
JOURNAL Cell 12 (1), 157-165 (1977)
PUBMED 71212
REFERENCE 2 (bases 176 to 730)
AUTHORS Shine,J., Seeburg,P.H., Martial,J.A., Baxter,J.D. and Goodman,H.M.
TITLE Construction and analysis of recombinant DNA for human chorionic
somatomammotropin
JOURNAL Nature 270 (5637), 494-499 (1977)
PUBMED 593368
REFERENCE 3 (bases 1 to 792)
AUTHORS Seeburg,P.H.
TITLE The human growth hormone gene family: nucleotide sequences show
recent divergence and predict a new polypeptide hormone
JOURNAL DNA 1 (3), 239-249 (1982)
PUBMED 7169009
COMMENT Original source text: Homo sapiens placenta cDNA to mRNA.
hpl-4 is one of four non-allelic human placental lactogen genes
(also known as chorionic somatomammotropin genes). The hpl-1 and
hpl-2 genes are probably not transcribed because restriction enzyme
analysis of placental mRNA fails to detect the fragments predicted
by these genes [1]. hpl-3 is transcribed and information from two
alleles coding for it has been sequenced <humpla>. hpl genes are
closely related to human growth hormone (hgh) genes. See loci
beginning <humgh>.
FEATURES Location/Qualifiers
source 1..792
/db_xref="H-InvDB:HIT000191042"
/organism="Homo sapiens"
/mol_type="mRNA"
/db_xref="taxon:9606"
/map="17q22-q24"
/tissue_type="placenta"
gene 1..792
/gene="CSH1"
mRNA <1..792
/gene="CSH1"
/note="G00-119-084"
CDS 30..683
/gene="CSH1"
/codon_start=1
/product="placental lactogen"
/protein_id="AAA98621.1"
/db_xref="GDB:G00-119-084"
/translation="MAPGSRTSLLLAFALLCLPWLQEAGAVQTVPLSRLFDHAMLQAH
RAHQLAIDTYQEFEETYIPKDQKYSFLHDSQTSFCFSDSIPTPSNMEETQQKSNLELL
RISLLLIESWLEPVRFLRSMFANNLVYDTSDSDDYHLLKDLEEGIQTLMGRLEDGSRR
TGQILKQTYSKFDTNSHNHDALLKNYGLLYCFRKDMDKVETFLRMVQCRSVEGSCGF"
sig_peptide 30..107
/gene="CSH1"
/note="G00-119-084"
mat_peptide 108..680
/gene="CSH1"
/product="placental lactogen"
/note="G00-119-084"
regulatory 769..774
/regulatory_class="polyA_signal_sequence"
/gene="CSH1"
/note="G00-119-084"
BASE COUNT 174 a 252 c 195 g 171 t
ORIGIN 170bp 5' to PvuII.
1 gggtcctgtg gacagctcac ctagtggcaa tggctccagg ctcccggacg tccctgctcc
61 tggcttttgc cctgctctgc ctgccctggc ttcaagaggc tggtgccgtc caaaccgttc
121 cgttatccag gctttttgac cacgctatgc tccaagccca tcgcgcgcac cagctggcca
181 ttgacaccta ccaggagttt gaagaaacct atatcccaaa ggaccagaag tattcgttcc
241 tgcatgactc ccagacctcc ttctgcttct cagactctat tccgacaccc tccaacatgg
301 aggaaacgca acagaaatcc aatctagagc tgctccgcat ctccctgctg ctcatcgagt
361 cgtggctgga gcccgtgcgg ttcctcagga gtatgttcgc caacaacctg gtgtatgaca
421 cctcggacag cgatgactat cacctcctaa aggacctaga ggaaggcatc caaacgctga
481 tggggaggct ggaagacggc agccgccgga ctgggcagat cctcaagcag acctacagca
541 agtttgacac aaactcgcac aaccatgacg cactgctcaa gaactacggg ctgctctact
601 gcttcaggaa ggacatggac aaggtcgaga cattcctgcg catggtgcag tgccgctctg
661 tggagggcag ctgtggcttc taggtgcccg agtagcatcc tgtgacccct ccccagtgcc
721 tctcctggcc cctgaaggtg ccactccagt gcccaccagc cttgtcctaa taaaattaag
781 ttgtatcatt tc
//